JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CRABP1

Description	Cellular retinoic acid-binding protein 1

Gene and Protein Information

Gene ID	1381
Uniprot Accession IDs	P29762 Q6IAY7 Q8WTV5
Ensembl ID	ENSG00000166426
Symbol	RBP5 RBP5 CRABP CRABPI CRABP-I
Chromosome	15
Family	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence	MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	740693	CRABP1	cellular retinoic acid binding protein 1	9598	VGNC:2478	OMA, EggNOG
Macaque	710048	CRABP1	cellular retinoic acid binding protein 1	9544		Inparanoid, OMA, EggNOG
Mouse	12903	Crabp1	cellular retinoic acid binding protein I	10090	MGI:88490	Inparanoid, OMA, EggNOG
Rat	25061	Crabp1	cellular retinoic acid binding protein 1	10116	RGD:2400	Inparanoid, OMA, EggNOG
Horse	100050413	CRABP1	cellular retinoic acid binding protein 1	9796	VGNC:16846	Inparanoid, OMA, EggNOG
Cow	282201	CRABP1	cellular retinoic acid binding protein 1	9913	VGNC:27685	Inparanoid, OMA, EggNOG
Pig	100169745	CRABP1	cellular retinoic acid binding protein 1	9823		Inparanoid, OMA, EggNOG
Opossum	100012644	CRABP1	cellular retinoic acid binding protein 1	13616		Inparanoid, EggNOG
Chicken	374211	CRABP1	cellular retinoic acid binding protein 1	9031	CGNC:49086	Inparanoid, OMA
Zebrafish	415102	crabp1b	cellular retinoic acid binding protein 1b	7955	ZDB-GENE-040624-3	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.