JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB7B

Description	Ras-related protein Rab-7b

Gene and Protein Information

Gene ID	338382
Uniprot Accession IDs	Q96AH8
Ensembl ID	ENSG00000276600
Symbol	RAB7
Chromosome	1
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	226421	Rab7b	RAB7B, member RAS oncogene family	10090	MGI:2442295	Inparanoid, OMA
Rat	501854	Rab7b	Rab7b, member RAS oncogene family	10116	RGD:1562617	Inparanoid, OMA
Cow	538050	RAB7B	RAB7B, member RAS oncogene family	9913	VGNC:33661	Inparanoid, OMA
Xenopus	100124979	rab7b	RAB7B, member RAS oncogene family	8364	XB-GENE-5824213	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.