JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RCC1

Description	Regulator of chromosome condensation

Gene and Protein Information

Gene ID	1104
Uniprot Accession IDs	P18754 Q16269 Q6NT97
Ensembl ID	ENSG00000180198
Symbol	CHC1 CHC1 RCC1-I SNHG3-RCC1
Chromosome	1
Sequence	MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	100568439	RCC1	regulator of chromosome condensation 1	9598	VGNC:1486	Inparanoid, OMA, EggNOG
Mouse	100088	Rcc1	regulator of chromosome condensation 1	10090	MGI:1913989	Inparanoid, OMA, EggNOG
Rat	682908	Rcc1	regulator of chromosome condensation 1	10116	RGD:1592835	Inparanoid, OMA, EggNOG
Dog	487332	RCC1	regulator of chromosome condensation 1	9615	VGNC:45440	Inparanoid, OMA, EggNOG
Horse	100070733	RCC1	regulator of chromosome condensation 1	9796	VGNC:22267	Inparanoid, OMA, EggNOG
Cow	534142	RCC1	regulator of chromosome condensation 1	9913	VGNC:33825	Inparanoid, OMA, EggNOG
Pig	100621543	RCC1	regulator of chromosome condensation 1	9823		Inparanoid, OMA, EggNOG
Opossum	100020625	RCC1	regulator of chromosome condensation 1	13616		Inparanoid, OMA, EggNOG
Platypus		RCC1	regulator of chromosome condensation 1 [Source:HGNC Symbol;Acc:HGNC:1913]	9258		OMA, EggNOG
Anole lizard	100553743	rcc1	regulator of chromosome condensation 1	28377		Inparanoid, OMA, EggNOG
Xenopus	548855	rcc1	regulator of chromosome condensation 1	8364	XB-GENE-979094	Inparanoid, OMA, EggNOG
Zebrafish	406457	rcc1	regulator of chromosome condensation 1	7955	ZDB-GENE-040426-2216	Inparanoid, OMA, EggNOG
C. elegans	174332	ran-3	Regulator of chromosome condensation	6239		Inparanoid, OMA
Fruitfly	38669	Rcc1	Regulator of chromosome condensation 1	7227	FBgn0002638	Inparanoid, OMA, EggNOG
S.cerevisiae	852782	SRM1	Ran guanyl-nucleotide exchange factor	4932	S000003065	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.