JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB5C

Description	Ras-related protein Rab-5C

Gene and Protein Information

Gene ID	5878
Uniprot Accession IDs	P51148 F8W1H5 Q6FH55 Q9P0Y5
Ensembl ID	ENSG00000108774
Symbol	RABL RABL L1880 RAB5L RAB5CL
Chromosome	17
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454678	RAB5C	RAB5C, member RAS oncogene family	9598	VGNC:14189	OMA, EggNOG
Mouse	19345	Rab5c	RAB5C, member RAS oncogene family	10090	MGI:105306	Inparanoid, OMA
Rat	287709	Rab5c	RAB5C, member RAS oncogene family	10116	RGD:1307095	Inparanoid, OMA
Dog	403941	RAB5C	RAB5C, member RAS oncogene family	9615		Inparanoid, OMA
Horse	100053004	RAB5C	RAB5C, member RAS oncogene family	9796	VGNC:49530	Inparanoid, OMA
Cow	613749	RAB5C	RAB5C, member RAS oncogene family	9913	VGNC:50253	Inparanoid, OMA
Opossum	100011633	RAB5C	RAB5C, member RAS oncogene family	13616		Inparanoid, OMA
Chicken	395197	RAB5C	RAB5C, member RAS oncogene family	9031	CGNC:2444	Inparanoid, OMA
Anole lizard	100566945	rab5c	RAB5C, member RAS oncogene family	28377		Inparanoid, OMA
Xenopus	594914	rab5c	RAB5C, member RAS oncogene family	8364	XB-GENE-494292	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.