The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
RAB5C
| Description |
Ras-related protein Rab-5C
|
Gene and Protein Information
| Gene ID |
5878
|
| Uniprot Accession IDs |
P51148
F8W1H5
Q6FH55
Q9P0Y5
|
| Ensembl ID |
ENSG00000108774
|
| Symbol |
RABL
RABL
L1880
RAB5L
RAB5CL
|
| Chromosome |
17
|
| Family |
Belongs to the small GTPase superfamily. Rab family. |
| Sequence |
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
454678 |
RAB5C |
RAB5C, member RAS oncogene family |
9598 |
VGNC:14189 |
OMA, EggNOG |
| Mouse |
19345 |
Rab5c |
RAB5C, member RAS oncogene family |
10090 |
MGI:105306 |
Inparanoid, OMA |
| Rat |
287709 |
Rab5c |
RAB5C, member RAS oncogene family |
10116 |
RGD:1307095 |
Inparanoid, OMA |
| Dog |
403941 |
RAB5C |
RAB5C, member RAS oncogene family |
9615 |
|
Inparanoid, OMA |
| Horse |
100053004 |
RAB5C |
RAB5C, member RAS oncogene family |
9796 |
VGNC:49530 |
Inparanoid, OMA |
| Cow |
613749 |
RAB5C |
RAB5C, member RAS oncogene family |
9913 |
VGNC:50253 |
Inparanoid, OMA |
| Opossum |
100011633 |
RAB5C |
RAB5C, member RAS oncogene family |
13616 |
|
Inparanoid, OMA |
| Chicken |
395197 |
RAB5C |
RAB5C, member RAS oncogene family |
9031 |
CGNC:2444 |
Inparanoid, OMA |
| Anole lizard |
100566945 |
rab5c |
RAB5C, member RAS oncogene family |
28377 |
|
Inparanoid, OMA |
| Xenopus |
594914 |
rab5c |
RAB5C, member RAS oncogene family |
8364 |
XB-GENE-494292 |
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.