The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
CRYZ
| Description |
Quinone oxidoreductase
|
Gene and Protein Information
| Gene ID |
1429
|
| Uniprot Accession IDs |
Q08257
A6NN60
D3DQ76
Q53FT0
Q59EU7
Q5HYE7
Q6NSK9
|
| Ensembl ID |
ENSG00000116791
|
| Chromosome |
1
|
| Family |
Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
| Sequence |
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
456952 |
CRYZ |
crystallin zeta |
9598 |
VGNC:10592 |
OMA, EggNOG |
| Macaque |
|
CRYZ |
glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:25346] |
9544 |
|
Inparanoid, EggNOG |
| Mouse |
12972 |
Cryz |
crystallin, zeta |
10090 |
MGI:88527 |
Inparanoid, OMA, EggNOG |
| Rat |
362061 |
Cryz |
crystallin zeta |
10116 |
RGD:1311639 |
Inparanoid, OMA, EggNOG |
| Dog |
611431 |
CRYZ |
crystallin zeta |
9615 |
|
Inparanoid, OMA, EggNOG |
| Horse |
100053415 |
CRYZ |
crystallin zeta |
9796 |
VGNC:16889 |
Inparanoid, OMA, EggNOG |
| Cow |
281093 |
CRYZ |
crystallin zeta |
9913 |
VGNC:27746 |
Inparanoid, OMA, EggNOG |
| Pig |
733653 |
CRYZ |
crystallin zeta |
9823 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
|
CRYZ |
crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419] |
13616 |
|
Inparanoid, OMA, EggNOG |
| Platypus |
100074501 |
CRYZ |
crystallin zeta |
9258 |
|
OMA, EggNOG |
| Chicken |
772289 |
CRYZ |
crystallin zeta |
9031 |
CGNC:8638 |
Inparanoid, OMA, EggNOG |
| Anole lizard |
100565320 |
LOC100565320 |
quinone oxidoreductase |
28377 |
|
OMA, EggNOG |
| Xenopus |
448193 |
cryz |
crystallin zeta |
8364 |
XB-GENE-966820 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
407640 |
cryz |
crystallin, zeta (quinone reductase) |
7955 |
ZDB-GENE-050306-24 |
Inparanoid, OMA, EggNOG |
| C. elegans |
173346 |
F39B2.3 |
hypothetical protein |
6239 |
|
OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.