JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

DUSP3

Description	Dual specificity protein phosphatase 3

Gene and Protein Information

Gene ID	1845
Uniprot Accession IDs	P51452 D3DX45 Q5U0J1 Q8IYJ9
Ensembl ID	ENSG00000108861
Symbol	VHR VHR
Chromosome	17
Family	Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Sequence	MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	468271	DUSP3	dual specificity phosphatase 3	9598	VGNC:12093	OMA, EggNOG
Macaque	713686	DUSP3	dual specificity phosphatase 3	9544		Inparanoid, OMA, EggNOG
Mouse	72349	Dusp3	dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)	10090	MGI:1919599	Inparanoid, OMA, EggNOG
Rat	498003	Dusp3	dual specificity phosphatase 3	10116	RGD:1560049	Inparanoid, OMA, EggNOG
Dog	480505	DUSP3	dual specificity phosphatase 3	9615	VGNC:53236	Inparanoid, OMA, EggNOG
Horse	100064999	DUSP3	dual specificity phosphatase 3	9796	VGNC:51807	Inparanoid, OMA, EggNOG
Cow	615432	DUSP3	dual specificity phosphatase 3	9913	VGNC:28259	Inparanoid, OMA, EggNOG
Pig	100512983	DUSP3	dual specificity phosphatase 3	9823		OMA, EggNOG
Opossum		DUSP3	dual specificity phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:3069]	13616		Inparanoid, OMA, EggNOG
Anole lizard	100555344	dusp3	dual specificity phosphatase 3	28377		Inparanoid, OMA, EggNOG
Zebrafish	100000665	dusp3a	dual specificity phosphatase 3a	7955	ZDB-GENE-111207-3	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.