JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

ERAS

Description	GTPase ERas

Gene and Protein Information

Gene ID	3266
Uniprot Accession IDs	Q7Z444 E-Ras
Ensembl ID	ENSG00000187682
Symbol	HRAS2 HRASP HRAS2 HRASP
Chromosome	X
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	711442	ERAS	ES cell expressed Ras	9544		Inparanoid, OMA
Mouse	353283	Eras	ES cell-expressed Ras	10090	MGI:2665023	Inparanoid, OMA
Dog	491869	ERAS	ES cell expressed Ras	9615	VGNC:40435	Inparanoid, OMA
Horse	100062317	ERAS	ES cell expressed Ras	9796	VGNC:17648	Inparanoid, OMA
Cow	540065	ERAS	ES cell expressed Ras	9913	VGNC:28562	Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / GTPase ERas

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / GTPase ERas

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.