JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB8A

Description	Ras-related protein Rab-8A

Gene and Protein Information

Gene ID	4218
Uniprot Accession IDs	P61006 B4DEK7 P24407 Q6FHV5
Ensembl ID	ENSG00000167461
Symbol	MEL RAB8 MEL RAB8
Chromosome	19
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	468760	RAB8A	RAB8A, member RAS oncogene family	9598	VGNC:7571	OMA, EggNOG
Macaque	100423251	RAB8A	RAB8A, member RAS oncogene family	9544		Inparanoid, OMA, EggNOG
Mouse	17274	Rab8a	RAB8A, member RAS oncogene family	10090	MGI:96960	Inparanoid, OMA, EggNOG
Rat	117103	Rab8a	RAB8A, member RAS oncogene family	10116	RGD:621144	Inparanoid, OMA, EggNOG
Dog	403773	RAB8A	RAB8A, member RAS oncogene family	9615	VGNC:45295	Inparanoid, OMA
Horse	100147248	RAB8A	RAB8A, member RAS oncogene family	9796	VGNC:22128	Inparanoid, OMA
Cow	100125881	RAB8A	RAB8A, member RAS oncogene family	9913	VGNC:33662	Inparanoid, OMA
Pig	100511006	RAB8A	RAB8A, member RAS oncogene family	9823		Inparanoid, OMA
Chicken	428352	RAB8A	RAB8A, member RAS oncogene family	9031	CGNC:66558	Inparanoid, OMA
Xenopus	100125217	rab8a	RAB8A, member RAS oncogene family	8364	XB-GENE-1018135	Inparanoid, OMA
Zebrafish	571897	rab8a	RAB8A, member RAS oncogene family	7955	ZDB-GENE-070424-36	Inparanoid, OMA
C. elegans	171935	rab-8	RAB family	6239		Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.