The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
RAD18
| Description |
E3 ubiquitin-protein ligase RAD18
|
Gene and Protein Information
| Gene ID |
56852
|
| Uniprot Accession IDs |
Q9NS91
Q58F55
Q9NRT6
|
| Ensembl ID |
ENSG00000070950
|
| Symbol |
RNF73
RNF73
|
| Chromosome |
3
|
| Family |
Belongs to the RAD18 family. |
| Sequence |
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
460144 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9598 |
VGNC:2530 |
OMA, EggNOG |
| Macaque |
704708 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9544 |
|
OMA, EggNOG |
| Mouse |
58186 |
Rad18 |
RAD18 E3 ubiquitin protein ligase |
10090 |
MGI:1890476 |
Inparanoid, OMA, EggNOG |
| Rat |
362412 |
Rad18 |
RAD18 E3 ubiquitin protein ligase |
10116 |
RGD:1306993 |
Inparanoid, OMA, EggNOG |
| Dog |
476544 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9615 |
VGNC:45312 |
Inparanoid, OMA, EggNOG |
| Horse |
100052645 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9796 |
VGNC:22143 |
Inparanoid, OMA, EggNOG |
| Cow |
514440 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9913 |
VGNC:33679 |
Inparanoid, OMA, EggNOG |
| Pig |
100217383 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9823 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
100023569 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
13616 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
416114 |
RAD18 |
RAD18, E3 ubiquitin protein ligase |
9031 |
CGNC:6341 |
Inparanoid, OMA, EggNOG |
| Xenopus |
|
RAD18 |
RAD18, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:18278] |
8364 |
|
OMA, EggNOG |
| Zebrafish |
393106 |
rad18 |
RAD18 E3 ubiquitin protein ligase |
7955 |
ZDB-GENE-040426-745 |
Inparanoid, OMA, EggNOG |
| S.cerevisiae |
850430 |
RAD18 |
E3 ubiquitin-protein ligase RAD18 |
4932 |
S000000662 |
Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.