JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PELI1

Description	E3 ubiquitin-protein ligase pellino homolog 1

Gene and Protein Information

Gene ID	57162
Uniprot Accession IDs	Q96FA3 Q96SM0 Q9GZY5 Q9HCX0 Pellino-1
Ensembl ID	ENSG00000197329
Symbol	PRISM
Chromosome	2
Family	Belongs to the pellino family.
Sequence	MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	746407	PELI1	pellino E3 ubiquitin protein ligase 1	9598	VGNC:333	OMA, EggNOG
Mouse	67245	Peli1	pellino 1	10090	MGI:1914495	Inparanoid, OMA, EggNOG
Rat	305549	Peli1	pellino E3 ubiquitin protein ligase 1	10116	RGD:1311199	Inparanoid, OMA
Dog	481388	PELI1	pellino E3 ubiquitin protein ligase 1	9615	VGNC:44414	Inparanoid, OMA
Horse	100051401	PELI1	pellino E3 ubiquitin protein ligase 1	9796	VGNC:21305	Inparanoid, OMA
Cow	535054	PELI1	pellino E3 ubiquitin protein ligase 1	9913	VGNC:32740	Inparanoid, OMA
Platypus	100078304	PELI1	pellino E3 ubiquitin protein ligase 1	9258		Inparanoid, OMA
Chicken	421279	PELI1	pellino E3 ubiquitin protein ligase 1	9031	CGNC:51458	Inparanoid, OMA
Anole lizard	100553038	peli1	pellino E3 ubiquitin protein ligase 1	28377		Inparanoid, OMA
Xenopus	100125008	peli2	pellino E3 ubiquitin protein ligase family member 2	8364	XB-GENE-992979	Inparanoid, OMA
Zebrafish	558420	peli1b	pellino E3 ubiquitin protein ligase 1b	7955	ZDB-GENE-061027-372	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.