JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PDGFB

Description	Platelet-derived growth factor subunit B

Gene and Protein Information

Gene ID	5155
Uniprot Accession IDs	P01127 G3XAG8 P78431 Q15354 Q6FHE7 Q9UF23 PDGF subunit B
Ensembl ID	ENSG00000100311
Symbol	PDGF2 SIS SIS SSV IBGC5 PDGF2 c-sis PDGF-2
Chromosome	22
Family	Belongs to the PDGF/VEGF growth factor family.
Sequence	MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458844	PDGFB	platelet derived growth factor subunit B	9598	VGNC:6704	OMA, EggNOG
Macaque	703173	PDGFB	platelet derived growth factor subunit B	9544		Inparanoid, OMA, EggNOG
Mouse	18591	Pdgfb	platelet derived growth factor, B polypeptide	10090	MGI:97528	Inparanoid, OMA, EggNOG
Rat	24628	Pdgfb	platelet derived growth factor subunit B	10116	RGD:3283	Inparanoid, OMA, EggNOG
Dog	442986	PDGFB	platelet derived growth factor subunit B	9615	VGNC:44369	Inparanoid, OMA, EggNOG
Horse		PDGFB	platelet derived growth factor subunit B [Source:HGNC Symbol;Acc:HGNC:8800]	9796		OMA, EggNOG
Cow	540106	PDGFB	platelet derived growth factor subunit B	9913	VGNC:32690	Inparanoid, OMA, EggNOG
Opossum	100012899	PDGFB	platelet derived growth factor subunit B	13616		Inparanoid, OMA, EggNOG
Chicken	374128	PDGFB	platelet derived growth factor subunit B	9031	CGNC:9243	Inparanoid, OMA
Xenopus	100492827	pdgfb	platelet derived growth factor subunit B	8364	XB-GENE-487583	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Platelet-derived growth factor subunit B

DTO Classes
protein / Signaling / Growth factor / Platelet-derived growth factor subunit B

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.