JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PDGFC

Description	Platelet-derived growth factor C

Gene and Protein Information

Gene ID	56034
Uniprot Accession IDs	Q9NRA1 B4DU34 B9EGR8 Q4W5M9 Q9UL22 PDGF-C
Ensembl ID	ENSG00000145431
Symbol	SCDGF SCDGF FALLOTEIN
Chromosome	4
Family	Belongs to the PDGF/VEGF growth factor family.
Sequence	MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	736477	PDGFC	platelet derived growth factor C	9598	VGNC:657	OMA, EggNOG
Macaque	700236	PDGFC	platelet derived growth factor C	9544		Inparanoid, OMA, EggNOG
Mouse	54635	Pdgfc	platelet-derived growth factor, C polypeptide	10090	MGI:1859631	Inparanoid, OMA, EggNOG
Rat	79429	Pdgfc	platelet derived growth factor C	10116	RGD:68410	Inparanoid, OMA, EggNOG
Dog	482666	PDGFC	platelet derived growth factor C	9615	VGNC:44370	Inparanoid, OMA, EggNOG
Horse	100062015	PDGFC	platelet derived growth factor C	9796	VGNC:21259	Inparanoid, OMA, EggNOG
Cow	613787	PDGFC	platelet derived growth factor C	9913	VGNC:53915	Inparanoid, OMA, EggNOG
Pig	100515267	PDGFC	platelet derived growth factor C	9823		OMA, EggNOG
Opossum	100023701	PDGFC	platelet derived growth factor C	13616		Inparanoid, OMA, EggNOG
Platypus	100079757	PDGFC	platelet derived growth factor C	9258		Inparanoid, OMA, EggNOG
Chicken	395469	PDGFC	platelet derived growth factor C	9031	CGNC:7129	Inparanoid, OMA, EggNOG
Anole lizard	100568114	pdgfc	platelet derived growth factor C	28377		Inparanoid, OMA, EggNOG
Xenopus	100494492	pdgfc	platelet derived growth factor C	8364	XB-GENE-985688	Inparanoid, OMA, EggNOG
Zebrafish	560564	pdgfc	platelet derived growth factor c	7955	ZDB-GENE-071217-2	OMA, EggNOG

PANTHER Classes
protein / signaling molecule / growth factor / Platelet-derived growth factor C

DTO Classes
protein / Signaling / Growth factor / Platelet-derived growth factor C

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.