JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RALB

Description	Ras-related protein Ral-B

Gene and Protein Information

Gene ID	5899
Uniprot Accession IDs	P11234 B4E040 Q53T32 Q6ZS74
Ensembl ID	ENSG00000144118
Chromosome	2
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	64143	Ralb	v-ral simian leukemia viral oncogene B	10090	MGI:1927244	Inparanoid, OMA, EggNOG
Rat	116546	Ralb	RAS like proto-oncogene B	10116	RGD:619852	Inparanoid, OMA
Dog	483881	RALB	RAS like proto-oncogene B	9615	VGNC:45331	Inparanoid, OMA, EggNOG
Horse	100060199	RALB	RAS like proto-oncogene B	9796	VGNC:22160	Inparanoid, OMA, EggNOG
Cow	505238	RALB	RAS like proto-oncogene B	9913	VGNC:33699	Inparanoid, OMA, EggNOG
Pig	100624229	RALB	RAS like proto-oncogene B	9823		OMA, EggNOG
Opossum	100010449	RALB	RAS like proto-oncogene B	13616		Inparanoid, OMA, EggNOG
Anole lizard	100563317	ralb	RAS like proto-oncogene B	28377		Inparanoid, OMA, EggNOG
Zebrafish	445255	ralba	v-ral simian leukemia viral oncogene homolog Ba (ras related)	7955	ZDB-GENE-040801-267	Inparanoid, OMA, EggNOG
C. elegans	175433	ral-1	RAL (Ras-related GTPase) homolog	6239		Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related protein Ral-B

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related protein Ral-B

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.