JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

CRABP2

Description	Cellular retinoic acid-binding protein 2

Gene and Protein Information

Gene ID	1382
Uniprot Accession IDs	P29373 B2R4Z8 D3DVC5 F1T098 Q6ICN6
Ensembl ID	ENSG00000143320
Symbol	RBP6 CRABP-II
Chromosome	1
Family	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence	MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469838	CRABP2	cellular retinoic acid binding protein 2	9598	VGNC:509	OMA, EggNOG
Macaque	718579	CRABP2	cellular retinoic acid binding protein 2	9544		Inparanoid, OMA, EggNOG
Mouse	12904	Crabp2	cellular retinoic acid binding protein II	10090	MGI:88491	Inparanoid, OMA, EggNOG
Rat	29563	Crabp2	cellular retinoic acid binding protein 2	10116	RGD:62070	Inparanoid, OMA, EggNOG
Dog	612093	CRABP2	cellular retinoic acid binding protein 2	9615	VGNC:39588	Inparanoid, OMA, EggNOG
Horse	100058072	CRABP2	cellular retinoic acid binding protein 2	9796	VGNC:16847	Inparanoid, OMA, EggNOG
Cow	493998	CRABP2	cellular retinoic acid binding protein 2	9913	VGNC:27686	Inparanoid, OMA, EggNOG
Pig	100155151	CRABP2	cellular retinoic acid binding protein 2	9823		Inparanoid, OMA, EggNOG
Opossum	100018489	CRABP2	cellular retinoic acid binding protein 2	13616		Inparanoid, OMA, EggNOG
Anole lizard	100556219	crabp2	cellular retinoic acid binding protein 2	28377		Inparanoid, OMA
Xenopus	448629	crabp2	cellular retinoic acid binding protein 2	8364	XB-GENE-959098	Inparanoid, OMA
Zebrafish	503502	crabp2b	cellular retinoic acid binding protein 2, b	7955	ZDB-GENE-050208-52	Inparanoid, OMA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.