JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

COX6B1

Description	Cytochrome c oxidase subunit 6B1

Gene and Protein Information

Gene ID	1340
Uniprot Accession IDs	P14854 B2R5C9 Q6IBL4
Ensembl ID	ENSG00000126267
Symbol	COX6B COXG COX6B COXVIb1
Chromosome	19
Family	Belongs to the cytochrome c oxidase subunit 6B family.
Sequence	MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	745426	COX6B1	cytochrome c oxidase subunit 6B1	9598	VGNC:7610	OMA, EggNOG
Macaque	692062	COX6B1	cytochrome c oxidase subunit 6B	9544		Inparanoid, OMA, EggNOG
Mouse	110323	Cox6b1	cytochrome c oxidase, subunit VIb polypeptide 1	10090	MGI:107460	Inparanoid, OMA, EggNOG
Rat		Cox6b1	cytochrome c oxidase subunit 6B1 [Source:RGD Symbol;Acc:1584097]	10116		OMA, EggNOG
Dog	612644	LOC612644	cytochrome c oxidase subunit 6B1	9615		Inparanoid, OMA, EggNOG
Horse	100051249	COX6B1	cytochrome c oxidase subunit 6B1	9796	VGNC:16807	Inparanoid, OMA, EggNOG
Pig	100038022	COX6B	COX6B protein	9823		Inparanoid, OMA, EggNOG
Opossum	100013297	LOC100013297	cytochrome c oxidase subunit 6B1	13616		OMA, EggNOG
Anole lizard	100554634	LOC100554634	cytochrome c oxidase subunit 6B1	28377		OMA, EggNOG
Zebrafish	436968	cox6b1	cytochrome c oxidase subunit VIb polypeptide 1	7955	ZDB-GENE-040718-448	OMA, EggNOG
Zebrafish	393478	cox6b2	cytochrome c oxidase subunit VIb polypeptide 2	7955	ZDB-GENE-040426-1566	Inparanoid, OMA
S.cerevisiae	850727	COX12	cytochrome c oxidase subunit VIb	4932	S000004028	OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.