The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PDCD6
| Description |
Programmed cell death protein 6
|
Gene and Protein Information
| Gene ID |
10016
|
| Uniprot Accession IDs |
O75340
B2RD16
E7ESR3
Q2YDC2
Q5TZS0
|
| Ensembl ID |
ENSG00000249915
|
| Symbol |
ALG2
ALG2
ALG-2
PEF1B
|
| Chromosome |
5
|
| Sequence |
MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
471813 |
PDCD6 |
programmed cell death 6 |
9598 |
VGNC:4123 |
OMA, EggNOG |
| Mouse |
18570 |
Pdcd6 |
programmed cell death 6 |
10090 |
MGI:109283 |
Inparanoid, OMA, EggNOG |
| Rat |
308061 |
Pdcd6 |
programmed cell death 6 |
10116 |
RGD:1311239 |
Inparanoid, OMA, EggNOG |
| Dog |
609549 |
PDCD6 |
programmed cell death 6 |
9615 |
VGNC:44340 |
Inparanoid, OMA, EggNOG |
| Horse |
|
PDCD6 |
programmed cell death 6 [Source:HGNC Symbol;Acc:HGNC:8765] |
9796 |
|
OMA, EggNOG |
| Cow |
100125927 |
PDCD6 |
programmed cell death 6 |
9913 |
VGNC:32663 |
Inparanoid, OMA, EggNOG |
| Opossum |
100011306 |
PDCD6 |
programmed cell death 6 |
13616 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
420988 |
PDCD6 |
programmed cell death 6 |
9031 |
CGNC:10082 |
Inparanoid, OMA, EggNOG |
| Xenopus |
493366 |
pdcd6 |
programmed cell death 6 |
8364 |
XB-GENE-960916 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
393925 |
pdcd6 |
programmed cell death 6 |
7955 |
ZDB-GENE-040426-1307 |
Inparanoid, OMA, EggNOG |
| C. elegans |
187448 |
M04F3.4 |
hypothetical protein |
6239 |
|
OMA, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.