JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB21

Description	Ras-related protein Rab-21

Gene and Protein Information

Gene ID	23011
Uniprot Accession IDs	Q9UL25 Q14466 Q569H3
Ensembl ID	ENSG00000080371
Symbol	KIAA0118
Chromosome	12
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467069	RAB21	RAB21, member RAS oncogene family	9598	VGNC:13352	OMA, EggNOG
Mouse	216344	Rab21	RAB21, member RAS oncogene family	10090	MGI:894308	Inparanoid, OMA, EggNOG
Rat	299799	Rab21	RAB21, member RAS oncogene family	10116	RGD:1303150	Inparanoid, OMA, EggNOG
Dog	100683312	RAB21	RAB21, member RAS oncogene family	9615	VGNC:45261	Inparanoid, OMA, EggNOG
Horse	100056811	RAB21	RAB21, member RAS oncogene family	9796	VGNC:22094	Inparanoid, OMA, EggNOG
Cow	781001	RAB21	RAB21, member RAS oncogene family	9913	VGNC:33628	Inparanoid, OMA, EggNOG
Platypus	100087487	RAB21	RAB21, member RAS oncogene family	9258		OMA, EggNOG
Chicken	771383	RAB21	RAB21, member RAS oncogene family	9031	CGNC:7744	Inparanoid, OMA, EggNOG
Anole lizard	100551608	rab21	RAB21, member RAS oncogene family	28377		Inparanoid, OMA, EggNOG
Xenopus	549073	rab21	RAB21, member RAS oncogene family	8364	XB-GENE-486436	Inparanoid, OMA, EggNOG
Zebrafish	767727	zgc:154045	zgc:154045	7955	ZDB-GENE-060929-1062	Inparanoid, OMA
C. elegans	187932	rab-21	RAB family	6239		Inparanoid, OMA
Fruitfly	3355163	Rab21	CG17515 gene product from transcript CG17515-RD	7227	FBgn0039966	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.