The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
HJV
Gene and Protein Information
| Gene ID |
148738
|
| Uniprot Accession IDs |
Q6ZVN8
B1ALI7
Q2PQ63
Q6IMF6
Q8NAH2
Q8WVJ5
|
| Ensembl ID |
ENSG00000168509
|
| Symbol |
HFE2
RGMC
JH
HFE2
RGMC
HFE2A
|
| Chromosome |
1
|
| Family |
Belongs to the repulsive guidance molecule (RGM) family. |
| Sequence |
MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ
Show more
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Macaque |
698805 |
HFE2 |
hemochromatosis type 2 (juvenile) |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
69585 |
Hfe2 |
hemochromatosis type 2 (juvenile) |
10090 |
MGI:1916835 |
Inparanoid, OMA, EggNOG |
| Rat |
310681 |
Hjv |
hemojuvelin BMP co-receptor |
10116 |
RGD:1310195 |
OMA, EggNOG |
| Dog |
475830 |
HJV |
hemojuvelin BMP co-receptor |
9615 |
VGNC:52597 |
OMA, EggNOG |
| Cow |
100335368 |
HJV |
hemojuvelin BMP co-receptor |
9913 |
VGNC:52785 |
OMA, EggNOG |
| Opossum |
100015121 |
HFE2 |
hemochromatosis type 2 (juvenile) |
13616 |
|
Inparanoid, OMA, EggNOG |
| Anole lizard |
100554388 |
LOC100554388 |
hemojuvelin |
28377 |
|
Inparanoid, OMA |
| C. elegans |
190602 |
drag-1 |
RGM domain family member drag-1 |
6239 |
|
Inparanoid, OMA |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.