This is a demo store. No orders will be fulfilled.
| Description | Replication factor C subunit 3 |
|---|
Gene and Protein Information
| Gene ID | 5983 |
|---|---|
| Uniprot Accession IDs | P40938 C9JU95 O15252 Q5W0E8 |
| Ensembl ID | ENSG00000133119 |
| Symbol | RFC38 |
| Chromosome | 13 |
| Family | Belongs to the activator 1 small subunits family. |
| Sequence |
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452533 | RFC3 | replication factor C subunit 3 | 9598 | VGNC:5099 | OMA, EggNOG |
| Macaque | 714220 | RFC3 | replication factor C subunit 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 69263 | Rfc3 | replication factor C (activator 1) 3 | 10090 | MGI:1916513 | Inparanoid, OMA, EggNOG |
| Rat | 288414 | Rfc3 | replication factor C subunit 3 | 10116 | RGD:1306832 | Inparanoid, OMA, EggNOG |
| Dog | 477308 | RFC3 | replication factor C subunit 3 | 9615 | VGNC:45494 | Inparanoid, OMA, EggNOG |
| Horse | 100062326 | RFC3 | replication factor C subunit 3 | 9796 | VGNC:22320 | Inparanoid, OMA, EggNOG |
| Cow | 515602 | RFC3 | replication factor C subunit 3 | 9913 | VGNC:33887 | Inparanoid, OMA, EggNOG |
| Pig | 100156440 | RFC3 | replication factor C subunit 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020774 | RFC3 | replication factor C subunit 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100078299 | RFC3 | replication factor C subunit 3 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418907 | RFC3 | replication factor C subunit 3 | 9031 | CGNC:12816 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558796 | rfc3 | replication factor C subunit 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100493161 | rfc3 | replication factor C subunit 3 | 8364 | XB-GENE-984444 | Inparanoid, OMA, EggNOG |
| Zebrafish | 259256 | rfc3 | replication factor C (activator 1) 3 | 7955 | ZDB-GENE-020809-3 | Inparanoid, OMA |
| C. elegans | 178259 | rfc-3 | RFC (DNA replication factor) family | 6239 | Inparanoid, OMA | |
| Fruitfly | 34550 | RfC38 | Replication factor C 38kD subunit | 7227 | FBgn0028700 | Inparanoid, EggNOG |
| S.cerevisiae | 852383 | RFC5 | replication factor C subunit 5 | 4932 | S000000291 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA-directed DNA polymerase / Replication factor C subunit 3
protein / nucleic acid binding / nucleotidyltransferase / Replication factor C subunit 3
protein / nucleic acid binding / DNA-directed DNA polymerase / Replication factor C subunit 3
protein / nucleic acid binding / nucleotidyltransferase / Replication factor C subunit 3
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed DNA polymerase / Replication factor C subunit 3
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed DNA polymerase / Replication factor C subunit 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later