JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RAB24

Description	Ras-related protein Rab-24

Gene and Protein Information

Gene ID	53917
Uniprot Accession IDs	Q969Q5 A0A024R7N9 Q7Z4Z7
Ensembl ID	ENSG00000169228
Chromosome	5
Family	Belongs to the small GTPase superfamily. Rab family.
Sequence	MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	471755	RAB24	RAB24, member RAS oncogene family	9598	VGNC:8633	OMA, EggNOG
Macaque	698876	RAB24	RAB24, member RAS oncogene family	9544		OMA, EggNOG
Mouse	19336	Rab24	RAB24, member RAS oncogene family	10090	MGI:105065	Inparanoid, OMA, EggNOG
Dog	479277	RAB24	RAB24, member RAS oncogene family	9615	VGNC:45264	Inparanoid, OMA, EggNOG
Horse	100058530	RAB24	RAB24, member RAS oncogene family	9796	VGNC:22097	Inparanoid, OMA, EggNOG
Cow	617635	RAB24	RAB24, member RAS oncogene family	9913	VGNC:33631	Inparanoid, OMA, EggNOG
Pig	100511865	RAB24	RAB24, member RAS oncogene family	9823		Inparanoid, OMA, EggNOG
Opossum	100027665	RAB24	RAB24, member RAS oncogene family	13616		Inparanoid, EggNOG
Chicken	427627	RAB24	RAB24, member RAS oncogene family	9031	CGNC:2157	Inparanoid, OMA, EggNOG
Anole lizard	100563654	rab24	RAB24, member RAS oncogene family	28377		Inparanoid, OMA, EggNOG
Xenopus	548925	rab24	RAB24, member RAS oncogene family	8364	XB-GENE-491489	Inparanoid, OMA, EggNOG
Zebrafish	574423	rab24	RAB24, member RAS oncogene family	7955	ZDB-GENE-050706-110	Inparanoid, OMA, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.