JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RHOA

Description	Transforming protein RhoA

Gene and Protein Information

Gene ID	387
Uniprot Accession IDs	P61586 P06749 Q53HM4 Q5U024 Q9UDJ0 Q9UEJ4
Ensembl ID	ENSG00000067560
Symbol	ARH12 ARHA RHO12 ARHA ARH12 RHO12 RHOH12
Chromosome	3
Family	Belongs to the small GTPase superfamily. Rho family.
Sequence	MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	461014	RHOA	ras homolog family member A	9598	VGNC:12171	OMA, EggNOG
Mouse	11848	Rhoa	ras homolog family member A	10090	MGI:1096342	Inparanoid, OMA
Rat	117273	Rhoa	ras homolog family member A	10116	RGD:619921	Inparanoid, OMA
Dog	403954	RHOA	ras homolog family member A	9615		Inparanoid, OMA
Cow	338049	RHOA	ras homolog family member A	9913	VGNC:33943	Inparanoid, OMA
Pig	396849	RHOA	ras homolog family member A	9823		Inparanoid, OMA
Opossum	100021110	RHOA	ras homolog family member A	13616		Inparanoid, OMA
Chicken	395442	RHOA	ras homolog family member A	9031	CGNC:49322	Inparanoid, OMA
Anole lizard	100566989	rhoa	ras homolog family member A	28377		Inparanoid, OMA
Xenopus	448080	rhoa	ras homolog family member A	8364	XB-GENE-489222	Inparanoid, OMA
Zebrafish	100006041	rhoab	ras homolog gene family, member Ab	7955	ZDB-GENE-040322-2	Inparanoid, OMA

PANTHER Classes
protein / enzyme modulator / small GTPase / Transforming protein RhoA

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Transforming protein RhoA

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.