JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

RHOB

Description	Rho-related GTP-binding protein RhoB

Gene and Protein Information

Gene ID	388
Uniprot Accession IDs	P62745 B2R692 P01121 Q5U0H6 Q7RTN5 Q7RTR9 Q9CUV7
Ensembl ID	ENSG00000143878
Symbol	ARH6 ARHB ARH6 ARHB RHOH6 MST081 MSTP081
Chromosome	2
Family	Belongs to the small GTPase superfamily. Rho family.
Sequence	MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	11852	Rhob	ras homolog family member B	10090	MGI:107949	Inparanoid, OMA, EggNOG
Rat	64373	Rhob	ras homolog family member B	10116	RGD:621309	Inparanoid, OMA
Dog	403670	RHOB	ras homolog family member B	9615	VGNC:45555	Inparanoid, OMA
Horse	100056328	RHOB	ras homolog family member B	9796	VGNC:22371	Inparanoid, OMA
Cow	515118	RHOB	ras homolog family member B	9913	VGNC:33944	Inparanoid, OMA, EggNOG
Platypus	100088097	RHOB	ras homolog family member B	9258		Inparanoid, OMA
Anole lizard	100558447	rhob	ras homolog family member B	28377		Inparanoid, OMA
Xenopus	407883	rhob	ras homolog family member B	8364	XB-GENE-478301	Inparanoid, OMA
Fruitfly	36775	Rho1	CG8416 gene product from transcript CG8416-RB	7227	FBgn0014020	OMA, EggNOG
S.cerevisiae	856294	RHO1	Rho family GTPase RHO1	4932	S000006369	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / enzyme modulator / small GTPase / Rho-related GTP-binding protein RhoB

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Rho-related GTP-binding protein RhoB

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.