This is a demo store. No orders will be fulfilled.
| Description | Serine/threonine-protein kinase pim-3 |
|---|
Gene and Protein Information
| Gene ID | 415116 |
|---|---|
| Uniprot Accession IDs | Q86V86 A5D8X8 A8K7J0 B1B0P0 Q68BM2 |
| Ensembl ID | ENSG00000198355 |
| Symbol | pim-3 |
| Chromosome | 22 |
| Family | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily. |
| Sequence |
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 223775 | Pim3 | proviral integration site 3 | 10090 | MGI:1355297 | Inparanoid, OMA, EggNOG |
| Rat | 64534 | Pim3 | Pim-3 proto-oncogene, serine/threonine kinase | 10116 | RGD:620462 | Inparanoid, OMA |
| Cow | 100336651 | PIM3 | Pim-3 proto-oncogene, serine/threonine kinase | 9913 | VGNC:32901 | Inparanoid, OMA, EggNOG |
| Opossum | PIM3 | Pim-3 proto-oncogene, serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:19310] | 13616 | Inparanoid, OMA | ||
| Anole lizard | 100561387 | pim3 | Pim-3 proto-oncogene, serine/threonine kinase | 28377 | Inparanoid, OMA | |
| Xenopus | 100497723 | pim3 | Pim-3 proto-oncogene, serine/threonine kinase | 8364 | XB-GENE-922022 | Inparanoid, OMA |
| Zebrafish | 565041 | pim3 | Pim-3 proto-oncogene, serine/threonine kinase | 7955 | ZDB-GENE-050809-111 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / protein kinase receptor / Serine/threonine-protein kinase pim-3
protein / receptor / protein kinase / Serine/threonine-protein kinase pim-3
protein / receptor / serine/threonine protein kinase receptor / Serine/threonine-protein kinase pim-3
protein / receptor / transferase / Serine/threonine-protein kinase pim-3
protein / receptor / kinase / Serine/threonine-protein kinase pim-3
protein / receptor / protein kinase receptor / Serine/threonine-protein kinase pim-3
protein / receptor / protein kinase / Serine/threonine-protein kinase pim-3
protein / receptor / serine/threonine protein kinase receptor / Serine/threonine-protein kinase pim-3
protein / receptor / transferase / Serine/threonine-protein kinase pim-3
protein / receptor / kinase / Serine/threonine-protein kinase pim-3
DTO Classes
protein / Kinase / Protein kinase / CAMK group / PIM family / Serine/threonine-protein kinase pim-3
protein / Kinase / Protein kinase / CAMK group / PIM family / Serine/threonine-protein kinase pim-3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later