This is a demo store. No orders will be fulfilled.

AGPAT1

Description 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha

Gene and Protein Information

Gene ID 10554
Uniprot Accession IDs Q99943 A2BFI5 Q5BL03
Ensembl ID ENSG00000204310
Symbol G15 G15 LPAATA 1-AGPAT1 LPAAT-alpha
Chromosome 6
Family Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Sequence
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources
Chimp 462582 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9598 VGNC:12570 OMA, EggNOG
Macaque 717174 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9544 Inparanoid, OMA
Mouse 55979 Agpat1 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) 10090 MGI:1932075 Inparanoid, OMA
Rat 406165 Agpat1 1-acylglycerol-3-phosphate O-acyltransferase 1 10116 RGD:1303287 Inparanoid, OMA
Dog 474857 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9615 VGNC:37710 Inparanoid, OMA
Horse 100059501 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9796 VGNC:15165 Inparanoid, OMA
Cow 282137 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9913 VGNC:25734 Inparanoid, OMA
Pig 613128 AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 9823 Inparanoid, OMA
Opossum AGPAT1 1-acylglycerol-3-phosphate O-acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:324] 13616 Inparanoid, OMA
Xenopus 100037898 agpat1 1-acylglycerol-3-phosphate O-acyltransferase 1 8364 XB-GENE-487933 Inparanoid, OMA

Associated Recombinant Proteins

Name Specification and purity Expression system Protein label Availability View Details

Associated Antibodies

Name Specifications Species reactivity Application Availability View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.