Il s'agit d'un magasin de démonstration. Aucune commande ne sera honorée.

PIP

Description Prolactin-inducible protein

Gene and Protein Information

Gene ID 5304
Uniprot Accession IDs P12273 A0A963 A0A9C3 A0A9F3 A4D2I1
Ensembl ID ENSG00000159763
Symbole GCDFP15 GPIP4 GPIP4 GCDFP15 GCDFP-15
Chromosome 7
Family Belongs to the PIP family.
Sequence
MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Homologous gene and protein info.
Species Gene ID Gene Symbol Nom Numéro d'identification fiscale Other Gene ID Sources
Chimp 494144 PIP prolactin induced protein 9598 VGNC:8733 Inparanoid, OMA, EggNOG
Mouse 18716 Pip prolactin induced protein 10090 MGI:102696 Inparanoid, OMA, EggNOG
Rat 64673 Pip prolactin induced protein 10116 RGD:70946 Inparanoid, OMA, EggNOG
Dog 608856 PIP prolactin induced protein 9615 VGNC:44570 Inparanoid, OMA, EggNOG
Horse 100629611 PIP prolactin induced protein 9796 VGNC:21461 Inparanoid, OMA, EggNOG
Cow 613853 PIP prolactin induced protein 9913 Inparanoid, EggNOG

Associated Recombinant Proteins

Nom Specification and purity Expression system Protein label Disponibilité Voir les détails

Associated Antibodies

Nom Specifications Species reactivity Application Disponibilité Voir les détails

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nom Direct Associated Targets Disease Type Mondoid

Bibliography

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.