JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

This is a demo store. No orders will be fulfilled.

Language

྾

PPIH

Description	Peptidyl-prolyl cis-trans isomerase H

Gene and Protein Information

Gene ID	10465
Uniprot Accession IDs	O43447 A6NNE7 PPIase H
Ensembl ID	ENSG00000171960
Symbol	CYP20 CYPH CYPH CYP-20 USA-CYP SnuCyp-20
Chromosome	1
Family	Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.
Sequence	MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469303	PPIH	peptidylprolyl isomerase H	9598	VGNC:6959	OMA, EggNOG
Macaque	697669	PPIH	peptidylprolyl isomerase H	9544		Inparanoid, OMA, EggNOG
Mouse	66101	Ppih	peptidyl prolyl isomerase H	10090	MGI:106499	Inparanoid, OMA, EggNOG
Rat	366461	Ppih	peptidylprolyl isomerase H	10116	RGD:1564921	Inparanoid, OMA, EggNOG
Dog	606899	PPIH	peptidylprolyl isomerase H	9615	VGNC:44854	Inparanoid, OMA, EggNOG
Horse	100053643	PPIH	peptidylprolyl isomerase H	9796	VGNC:21733	Inparanoid, OMA, EggNOG
Cow	513428	PPIH	peptidylprolyl isomerase H	9913	VGNC:33200	Inparanoid, OMA, EggNOG
Pig	100523448	PPIH	peptidylprolyl isomerase H	9823		Inparanoid, OMA, EggNOG
Opossum	100032668	PPIH	peptidylprolyl isomerase H	13616		Inparanoid, OMA, EggNOG
Chicken	419507	PPIH	peptidylprolyl isomerase H	9031	CGNC:3618	Inparanoid, OMA, EggNOG
Xenopus	394997	ppih	peptidylprolyl isomerase H	8364	XB-GENE-485863	Inparanoid, OMA, EggNOG
Zebrafish	494165	ppih	peptidylprolyl isomerase H (cyclophilin H)	7955	ZDB-GENE-040625-127	Inparanoid, OMA, EggNOG
C. elegans	174394	cyn-11	Peptidyl-prolyl cis-trans isomerase 11	6239		Inparanoid, OMA
Fruitfly	35571	CG17266	CG17266 gene product from transcript CG17266-RA	7227	FBgn0033089	Inparanoid, EggNOG

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

AntibodiesProductName	Specification and purity	Mechanism Of Action	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.