The store will not work correctly when cookies are disabled.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy.
PPIH
| Description |
Peptidyl-prolyl cis-trans isomerase H
|
Gene and Protein Information
| Gene ID |
10465
|
| Uniprot Accession IDs |
O43447
A6NNE7
PPIase H
|
| Ensembl ID |
ENSG00000171960
|
| Symbol |
CYP20
CYPH
CYPH
CYP-20
USA-CYP
SnuCyp-20
|
| Chromosome |
1
|
| Family |
Belongs to the cyclophilin-type PPIase family. PPIase H subfamily. |
| Sequence |
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
|
Homologous gene and protein info.
| Species |
Gene ID |
Gene Symbol |
Name |
Tax ID |
Other Gene ID |
Sources |
| Chimp |
469303 |
PPIH |
peptidylprolyl isomerase H |
9598 |
VGNC:6959 |
OMA, EggNOG |
| Macaque |
697669 |
PPIH |
peptidylprolyl isomerase H |
9544 |
|
Inparanoid, OMA, EggNOG |
| Mouse |
66101 |
Ppih |
peptidyl prolyl isomerase H |
10090 |
MGI:106499 |
Inparanoid, OMA, EggNOG |
| Rat |
366461 |
Ppih |
peptidylprolyl isomerase H |
10116 |
RGD:1564921 |
Inparanoid, OMA, EggNOG |
| Dog |
606899 |
PPIH |
peptidylprolyl isomerase H |
9615 |
VGNC:44854 |
Inparanoid, OMA, EggNOG |
| Horse |
100053643 |
PPIH |
peptidylprolyl isomerase H |
9796 |
VGNC:21733 |
Inparanoid, OMA, EggNOG |
| Cow |
513428 |
PPIH |
peptidylprolyl isomerase H |
9913 |
VGNC:33200 |
Inparanoid, OMA, EggNOG |
| Pig |
100523448 |
PPIH |
peptidylprolyl isomerase H |
9823 |
|
Inparanoid, OMA, EggNOG |
| Opossum |
100032668 |
PPIH |
peptidylprolyl isomerase H |
13616 |
|
Inparanoid, OMA, EggNOG |
| Chicken |
419507 |
PPIH |
peptidylprolyl isomerase H |
9031 |
CGNC:3618 |
Inparanoid, OMA, EggNOG |
| Xenopus |
394997 |
ppih |
peptidylprolyl isomerase H |
8364 |
XB-GENE-485863 |
Inparanoid, OMA, EggNOG |
| Zebrafish |
494165 |
ppih |
peptidylprolyl isomerase H (cyclophilin H) |
7955 |
ZDB-GENE-040625-127 |
Inparanoid, OMA, EggNOG |
| C. elegans |
174394 |
cyn-11 |
Peptidyl-prolyl cis-trans isomerase 11 |
6239 |
|
Inparanoid, OMA |
| Fruitfly |
35571 |
CG17266 |
CG17266 gene product from transcript CG17266-RA |
7227 |
FBgn0033089 |
Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name |
Specification and purity |
Expression system |
Protein label |
Availability |
View Details |
Associated Antibodies
| Name |
Specifications |
Species reactivity |
Application |
Availability |
View Details |
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name |
Direct Associated Targets |
Disease Type |
Mondoid |
Shall we send you a message when we have discounts available?
Remind me later
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.