Skip to the beginning of the images gallery

Recombinant MPXV M1R Protein

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: Q8V502
Protein Tag: C-His
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp155935

Grouped product items
SKU	Size	Availability	Price
rp155935-10μg	10μg	≥10	$129.90
rp155935-50μg	50μg	≥10	$419.90
rp155935-100μg	100μg	8	$659.90
rp155935-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,599.90

Animal Free, >95% (SDS-PAGE), 293 cell, C-His tag, 1-183 aa

View related series

Accession#:Q8V502 (1) Gene ID:928968 (1) M1R (1) MPXV (2)

Basic Description

Product Name	Recombinant MPXV M1R Protein
Synonyms	Monkeypox Virus \| MPV \| MPXV \| M1R \| IMV membrane protein M1R
Grade	Animal Free, Azide Free, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： The monkeypox virus is the causative agent of the infectious disease of monkeypox. The virus is a member of the Orthopoxvirus genus in the family Poxviridae. And its genome is a double-stranded DNA. The disease caused by the virus is similar to but milder than smallpox and its mortality is often much lower. Humans and animals are both hosts for monkeypox virus and both species are vulnerable to the virus and may develop diseases. Monkeypox virus is mainly distributed in rainforests of west and central Africa. Isolates from Central Africa and Western Africa is different in virulence and the former is more virulent than the latter. The virus could spread in animals and humans and direct contact with the body fluid of an infected animal or being bitten may infect the virus.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-183 aa
Sequence	MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGENLYFQGHHHHHH
Protein Tag	C-His
Accession #	Q8V502
Predicted molecular weight	33.9 kDa
SDS-PAGE	22-37 kDa, reducing conditions; 22-37 kDa, non-reducing conditions

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant MPXV M1R Protein (rp155935)

Recombinant MPXV M1R Protein (rp155935) - SDS-PAGE
3 μg/lane of Recombinant MPXV M1R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 22-37 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101736	Certificate of Analysis	Nov 20, 2023	rp155935
ZJ23F1101735	Certificate of Analysis	Nov 20, 2023	rp155935
ZJ23F1101734	Certificate of Analysis	Nov 20, 2023	rp155935
ZJ23R1100130	Certificate of Analysis	Nov 14, 2023	rp155935

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration