Skip to the beginning of the images gallery

Recombinant MPXV A29L Protein, ＞95% (SDS-PAGE), high purityused for WB,ELISA various applications

COA

Grade & Purity:

Carrier Free

Azide Free

≥95%(SDS-PAGE)

Expression System: E. coli
Accession #: Q77HM6
Protein Tag: N-His
Application: WB,ELISA

In stock

Item Number

rp155836

Grouped product items
SKU	Size	Availability	Price
rp155836-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$59.90
rp155836-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$269.90
rp155836-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,279.90

Carrier free, >95% (SDS-PAGE), E. coli, His tag, 1-110 aa

View related series

Accession#:Q77HM6 (14) Gene ID:928966 (14) MPXV A29L (1) OPG154 (1)

Basic Description

Product Name	Recombinant MPXV A29L Protein, ＞95% (SDS-PAGE), high purityused for WB,ELISA various applications
Synonyms	OPG154 \| A29L \| IMV surface protein A29L \| Monkeypox virus \| Monkeypox virus A29L
Grade	Azide Free, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description: Monkeypox is a zoonotic disease caused by monkeypox virus (MPXV), which is a member of orthopoxvirus genus. A29L is an intracellular mature virus (IMV) surface envelope protein that is homologous to vaccinia virus (VACV) A27 and is widely conserved in the Poxviridae family. The A27L protein (p14) is a multifunctional protein that has been implicated in virus attachment, virus–cell fusion, cell–cell fusion, plaque size, and the formation of enveloped virions. The involvement of A27 in mature virus (IMV) inhibits the assembly of fusion protein A26. After MVs are endocytosed by vesicles, the acidic endocytic environment activates the dissociation of A26 protein from MVs, resulting in fusion of the viral membrane with the vesicle membrane. A27 interacts with the integral membrane protein A17, and then forms a protein complex with A26 through disulfide bond linkage to anchor the A26 protein to mature virus (MV) particles.
Specifications & Purity	Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	＞95% (SDS-PAGE)
Expression System	E. coli
Species	Monkeypox virus
Amino Acids	1-110 aa
Sequence	MGSSHHHHHHSSGLVPRGSHMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Protein Tag	N-His
Protein Length	Full length protein
Accession #	Q77HM6
Source	Recombinant
Predicted molecular weight	14.7 kDa
SDS-PAGE	13.2 kDa, under reducing conditions; 37-46 kDa, under non-reducing conditions

Storage and Shipping

Application	WB,ELISA
Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant MPXV A29L Protein (rp155836)

Recombinant MPXV A29L Protein (rp155836) - SDS-PAGE
3 μg/lane of Recombinant MPXV A29L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 13.2 kDa under reducing conditions and 37-46 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0700584	Certificate of Analysis	Jul 14, 2023	rp155836

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration