Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp164523-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$219.90
|
|
|
rp164523-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$749.90
|
|
|
rp164523-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$1,199.90
|
|
|
rp164523-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$5,999.90
|
|
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-10*His tag, 22-402 aa
| Product Name | Recombinant Mouse Renin Protein |
|---|---|
| Synonyms | Angiotensinogenase | EC 3.4.23 | EC 3.4.23.15 | FLJ10761 | HNFJ2 | Prorenin | REN | renin precursor, renal | angiotensin-forming enzyme | Renin | Ren1 | Rnr | Rn-1 | Ren-1 | Ren-A | Ren1c | Ren1d |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description |
Function |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to cleave the fluorogenic peptide substrate 5-FAM/QXL™ 520. The specific activity is >20 pmol/min/μg, as measured under the described conditions. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 22-402 aa |
| Sequence | LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHHHHHH |
| Protein Tag | C-10His |
| Accession # | P06281 |
| Predicted molecular weight | 43 kDa |
| SDS-PAGE | 45 - 55 kDa, under reducing conditions; 45 - 55 kDa, under non-reducing conditions. |
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Mouse Renin Protein (rp164523) - SDS-PAGE
3 μg/lane of Recombinant Mouse Renin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 45 - 55 kDa.