This is a demo store. No orders will be fulfilled.

Recombinant Mouse MMP-9 Protein, ≥95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: P41245
  • Protein Tag: C-His
  • Bioactivity: Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >1900 pmol/min/μg.
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp154395
Grouped product items
SKU Size
Availability
Price Qty
rp154395-10μg
10μg
≥10
$139.90
rp154395-50μg
50μg
8
$599.90
rp154395-100μg
100μg
3
$1,099.90
rp154395-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$3,399.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-730 aa

Basic Description

Product Name Recombinant Mouse MMP-9 Protein, ≥95% (SDS-PAGE), high purity
Synonyms Matrix Metalloproteinase 9 | 92 kDa gelatinase | 92 kDa type IV collagenase | CLG4B | EC 3.4.24 | EC 3.4.24.35 | Gelatinase B | GELB | macrophage gelatinase | MANDP2 | matrix metallopeptidase 9 | matrix metalloproteinase-9 | MMP9 | MMP-9 | type V collagen
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity ≥95% (SDS-PAGE)
Bioactivity Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >1900 pmol/min/μg.
Endotoxin Concentration <0.1 EU/μg
Expression System HEK293
Species Mouse
Amino Acids 20-730 aa
Sequence APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCPHHHHHH
Protein Tag C-His
Accession # P41245
Predicted molecular weight 79.4 kDa
SDS-PAGE 100 - 110 kDa, under reducing conditions; 100 - 110 kDa, under non-reducing conditions.

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Mouse MMP-9 Protein (rp154395) - SDS-PAGE
3 μg/lane of Recombinant Mouse MMP-9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 100 - 110 kDa.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number Certificate Type Date Item
ZJ24F0607406 Certificate of Analysis Jun 28, 2024 rp154395
ZJ24F0607405 Certificate of Analysis Jun 28, 2024 rp154395
ZJ24F0607404 Certificate of Analysis Jun 28, 2024 rp154395

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.