Skip to the beginning of the images gallery

Recombinant Mouse Lumican Protein

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: P51885
Protein Tag: C-His
Bioactivity: Measured by the ability of the immobilized protein to support the adhesion of BCE C/D‑1b bovine corneal endothelial cells. When 5 x 10^4 cells per well are added to rmLumican coated plates (10 μg/mL, 100 μL/well) ≥ 50% will adhere after 50 minutes at 37 ℃.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp167235

Grouped product items
SKU	Size	Availability	Price
rp167235-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp167235-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$419.90
rp167235-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$669.90
rp167235-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,349.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 19-338 aa

View related series

Click to view protein information: LUM

Accession#: P51885 (1) Gene ID: 17022 (1) LUM (4) Lumican (4)

Basic Description

Product Name	Recombinant Mouse Lumican Protein
Synonyms	KSPG lumican \| LDC \| LUM \| lumican proteoglycan \| Lumican \| SLRR2D \| Keratan sulfate proteoglycan lumican
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Product Description	Background Lumican is a 40 kDa member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily. Mouse Lumican is synthesized as a 338 amino acid (aa) precursor that contains an 18 aa signal sequence and a 320 aa mature chain (SwissProt #: 51885). The mature chain contains a negatively charged N-terminal domain containing sulfated tyrosine and disulfide bonds, 12 leucine-rich repeats (LRRs), four potential sites of N-linked glycosylation, and a carboxyl terminal domain containing two conserved cysteines. Mature mouse Lumican is 98%, 88%, and 70% aa identical to mature rat, human, and chick Lumican, respectively. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins (ECM) proteins. Lumican is expressed in a variety of tissues, including skin, artery, lung, cornea, kidney, bone, aorta, and articular cartilage. Lumican’s rolein vivohas been found using Lumican null mice. These mice have functional deficits including corneal opacity as well as skin and tendon fragility associated with disorganized and loosely packed collagen fibers. The abnormal connective tissue phenotype seen in the Lumican null mice shows the importance of the role of Lumican in collagen fibrillogenesis. In addition to the control of collagen fibril assembly, Lumican has been shown to play a role in the regulation of cell proliferation, migration, and adhesion. Lumican’s overexpression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, High performance, ≥95%(SDS-PAGE)
Bioactivity	Measured by the ability of the immobilized protein to support the adhesion of BCE C/D‑1b bovine corneal endothelial cells. When 5 x 10^4 cells per well are added to rmLumican coated plates (10 μg/mL, 100 μL/well) ≥ 50% will adhere after 50 minutes at 37 ℃.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Amino Acids	19-338 aa
Sequence	QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVNHHHHHH
Protein Tag	C-His
Accession #	P51885
Predicted molecular weight	37.3 kDa
SDS-PAGE	40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions.

Storage and Shipping

Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Mouse Lumican Protein (rp167235)

Recombinant Mouse Lumican Protein (rp167235) - SDS-PAGE
2 μg/lane of Recombinant Mouse Lumican Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration