This is a demo store. No orders will be fulfilled.

Recombinant Mouse IL-4 Protein, >95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: P07750
  • Protein Tag: C-His
  • Bioactivity: Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
rp154228
Grouped product items
SKU Size
Availability
Price Qty
rp154228-10μg
10μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$89.90
rp154228-50μg
50μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$239.90
rp154228-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,759.90

GMP, ≥95% (SDS-PAGE), Active, HEK293, C-His, 21-140 aa

Basic Description

Product Name Recombinant Mouse IL-4 Protein, >95% (SDS-PAGE), high purity
Synonyms B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1 | IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | pitrakinra
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Product Description

 

Specifications & Purity Animal Free, Carrier Free, GMP, Bioactive, High Performance, ActiBioPure™, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface express
Purity >95% (SDS-PAGE)
Bioactivity Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.
Endotoxin Concentration <1.0 EU/μg
Expression System HEK293
Species Mouse
Amino Acids 21-140 aa
Sequence HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYSGGGGSHHHHHHHHHH
Protein Tag C-His
Protein Length Full length protein
Accession # P07750
Source Recombinant
Predicted molecular weight 15.2 kDa

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute in sterile H2O at not less than 100µg/ml, which can then be further diluted in other aqueous solutions.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20℃ for 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Mouse IL-4 Protein (rp154228)-Protein Bioactivity
Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.

Recombinant Mouse IL-4 Protein(rp154228)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.2 kDa.

Recombinant Mouse IL-4 Protein (rp154228) - Protein Bioactivity
Measured in a cell proliferation assay using assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <1.8 ng/mL.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

9 results found

Lot Number Certificate Type Date Item
ZJ24F0607418 Certificate of Analysis Jun 28, 2024 rp154228
ZJ24F0607417 Certificate of Analysis Jun 28, 2024 rp154228
ZJ24F0606576 Certificate of Analysis Jun 07, 2024 rp154228
ZJ24F0606575 Certificate of Analysis Jun 07, 2024 rp154228
ZJ24F0606574 Certificate of Analysis Jun 07, 2024 rp154228
ZJ23F0901081 Certificate of Analysis Sep 18, 2023 rp154228
ZJ23F0901080 Certificate of Analysis Sep 18, 2023 rp154228
ZJ23F0400115 Certificate of Analysis Apr 29, 2023 rp154228
ZJ23F0400114 Certificate of Analysis Apr 29, 2023 rp154228

Citations of This Product

1. Huirong Huang, Shimin Zheng, Jianing Wu, Xindan Liang, Shengjie Li, Pengfei Mao, Zhinan He, Yahui Chen, Lining Sun, Xinyu Zhao, Aimin Cai, Luhui Wang, Huixiang Sheng, Qing Yao, Ruijie Chen, Ying-Zheng Zhao, Longfa Kou.  (2024)  Opsonization Inveigles Macrophages Engulfing Carrier-Free Bilirubin/JPH203 Nanoparticles to Suppress Inflammation for Osteoarthritis Therapy.  Advanced Science,    (2400713). 

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.