Skip to the beginning of the images gallery

Recombinant Mouse IL-36 alpha/IL-1F6 Protein, ＞95%(SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)
See COA

Expression System: E.coli
Accession #: Q9JLA2
Protein Tag: N-terminal Met&6xHis-tagged
Bioactivity: Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ＜18 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp154218

Grouped product items
SKU	Size	Availability	Price
rp154218-5μg	5μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$59.90
rp154218-20μg	20μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$139.90
rp154218-50μg	50μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$219.90
rp154218-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,559.90

Animal Free, >95%(SDS-PAGE), Active, E.coli, No Tag, 8-160aa

View related series

Click to view protein information: IL36A

Accession#:Q9JLA2 (1) Gene ID:54448 (1) IL-1F6 (2) IL-36 alpha (2) IL36A (3)

Basic Description

Product Name	Recombinant Mouse IL-36 alpha/IL-1F6 Protein, ＞95%(SDS-PAGE), high purity
Synonyms	FIL1 epsilon \| FIL1 \| FIL1(EPSILON) \| FIL1E \| IL-1 epsilon \| IL1(EPSILON) \| IL1E \| IL-1E \| IL-1F6 (FIL-1-epsilon) \| IL1F6 \| IL-1F6 \| IL36 alpha \| IL-36 alpha \| IL36A \| interleukin 1 family, member 6 (epsilon) \| interleukin 1, epsilon \| Interleukin 36, Alp
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >95% SDS-PAGE. IL‑36 alpha is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. The receptor for IL‑36 alpha is a combination of IL‑1 Rrp2 (also called IL‑1 RL2 or IL‑1 R6), mainly found in epithelia and keratinocytes, and the widely expressed IL‑1 RAcP. IL‑36 alpha, beta and gamma all activate NF‑ kappa B and MAPK pathways in an IL‑1 Rrp2 dependent manner, and induce production of inflammatory cytokines and chemokines such as CXCL8/IL‑8. IL‑36 alpha and other family members are overexpressed in psoriatic skin lesions, and transgenic overexpression of IL‑36 alpha in skin keratinocytes produces epidermal hyperplasia. IL‑36 alpha is present in kidney tubule epithelia; it is highly overexpressed in tubulointerstitial lesions in mouse models of chronic glomerulonephritis, lupus nephritis and diabetic nephritis. IL‑36 alpha is induced by inflammation in adipose tissue‑resident alternately activated (M2) macrophages, and reduces adipocyte differentiation.
Specifications & Purity	Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, ≥95%(SDS-PAGE), See COA
Purity	＞95%(SDS-PAGE)
Bioactivity	Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ＜18 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E.coli
Species	Mouse
Amino Acids	8-160 aa
Sequence	MAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Protein Tag	N-terminal Met&6xHis-tagged
N-terminal Sequence	Met
Protein Length	Full length protein
Accession #	Q9JLA2
Source	Recombinant
Predicted molecular weight	13kDa
SDS-PAGE	15.5 kDa, under reducing conditions; 15.5 kDa, under non-reducing conditions.

Storage and Shipping

Shape	Lyophilized
Concentration	See COA
Reconstitution	Reconstitute in water to a concentration of 0.1-1.0 mg/ml.
Storage Temp	Store at -20°C
Shipped In	Ice chest + Ice pads
Stability And Storage	12 months from date of receipt, -20 to -70 °C as supplied.1 month, 2 to 8 °C under sterile conditions after reconstitution.3 months, -20 to -70 °C under sterile conditions after reconstitution.

Images

Protein Bioactivity: Recombinant Mouse IL-36 alpha/IL-1F6 Protein (rp154218)

Recombinant Mouse IL-36 alpha/IL-1F6 Protein (rp154218)-Protein Bioactivity
Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is <18 ng/mL.

SDS-PAGE: Recombinant Mouse IL-36 alpha/IL-1F6 Protein (rp154218)

Recombinant Mouse IL-36 alpha/IL-1F6 Protein (rp154218)-SDS-PAGE
2μg/lane Recombinant Mouse IL-36 alpha/IL-1F6 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 15.5 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0600289	Certificate of Analysis	Jun 12, 2023	rp154218
ZJ23F0600288	Certificate of Analysis	Jun 12, 2023	rp154218
ZJ23F0600287	Certificate of Analysis	Jun 12, 2023	rp154218
ZJ23F0600260	Certificate of Analysis	Jun 03, 2023	rp154218

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration