Skip to the beginning of the images gallery

Recombinant Mouse IL-13 Protein, ＞98%(SDS-PAGE,HPLC), high purity

Grade & Purity:

≥98%(SDS-PAGE&HPLC)

Expression System: E.coli
Accession #: P20109
Protein Tag: No tag
Bioactivity: Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.
Endotoxin Concentration: <0.01 EU/μg

In stock

Item Number

rp154139

Grouped product items
SKU	Size	Availability	Price
rp154139-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$179.90
rp154139-20μg	20μg	3	$279.90
rp154139-100μg	100μg	2	$999.90
rp154139-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,459.90

Animal free, ＞98%(SDS-PAGE,HPLC), Active, E.coli, No tag, 21-131 aa

View related series

Click to view protein information: IL13

Accession#:P20109 (1) Gene ID:16163 (1) IL13 (12)

Basic Description

Product Name	Recombinant Mouse IL-13 Protein, ＞98%(SDS-PAGE,HPLC), high purity
Synonyms	Allergic rhinitis \| ALRH \| BHR 1 \| BHR1 \| Bronchial hyperresponsiveness 1 (bronchial asthma) \| IL 13 \| IL-13 \| Il13 \| IL13_HUMAN \| Interleukin 13 \| Interleukin-13 \| interleukin13 \| MGC116786 \| MGC116788 \| MGC116789 \| NC 30 \| NC30 \| P 600 \| P60
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Murine Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 11 and secreted by many cell types, especially T helper type 2 (Th2) cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human, mouse and rat IL-13 share low homology, but have cross species activity. Recombinant Murine IL-13 is a 12.3kDa protein consisting of 111 amino acid residues Purity ＞98%(SDS-PAGE,HPLC) Function Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC)
Purity	＞98%(SDS-PAGE,HPLC)
Bioactivity	Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.
Endotoxin Concentration	<0.01 EU/μg
Expression System	E.coli
Species	Mouse
Amino Acids	22-131 aa
Sequence	MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGF CVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHF ITKLLSYTKQLFRHGPF
Protein Tag	No tag
Protein Length	Full length protein
Accession #	P20109
Source	Recombinant
Predicted molecular weight	12.3 kDa

Storage and Shipping

Shape	Lyophilized
Reconstitution	1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	For long term storage, the product should be stored ≤ -20℃ . Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Mouse IL-13 Protein (rp154139)

Recombinant Mouse IL-13 Protein (rp154139)-Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.

SDS-PAGE: Recombinant Mouse IL-13 Protein (rp154139)

Recombinant Mouse IL-13 Protein (rp154139)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-13 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 11.2 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0400125	Certificate of Analysis	Apr 29, 2023	rp154139
ZJ23F0400124	Certificate of Analysis	Apr 29, 2023	rp154139

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration