Skip to the beginning of the images gallery

Recombinant Human TL1A/TNFSF15 Protein

Grade & Purity:

≥90%(SDS-PAGE)

Expression System: E. coli
Accession #: O95150
Protein Tag: No tag
Bioactivity: Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED50 for this effect is typically 1.15 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp170417

Grouped product items
SKU	Size	Availability	Price
rp170417-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$129.90
rp170417-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$489.90
rp170417-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$729.90
rp170417-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,159.90

Carrier Free, ≥90% (SDS-PAGE), Active, E. coli, No tag, 72-251 aa

View related series

Click to view protein information: TNFSF15

Accession#:O95150 (1) Gene ID:9966 (1) TL1A/TNFSF15 (1) TNFSF15 (1)

Basic Description

Product Name	Recombinant Human TL1A/TNFSF15 Protein
Synonyms	MGC129934 \| MGC129935 \| TL1A \| TL1Vascular endothelial cell growth inhibitor \| TNF superfamily ligand TL1A \| TNFSF15 \| tumor necrosis factor (ligand) superfamily, member 15 \| tumor necrosis factor ligand superfamily member 15 \| vascular endothelial growth
Grade	ActiBioPure™, Bioactive, Carrier Free, High Performance
Product Description	Protein Function: TL1A, also known as TNFSF15, is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is specifically expressed in endothelial cells. TL1A also can be detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon. TL1A is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It mediates activation of NF-kappa-B. It also inhibits vascular endothelial growth and angiogenesis (in vitro). TL1A promotes activation of caspases and apoptosis. It is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.
Specifications & Purity	Carrier Free, Bioactive, High performance, ActiBioPure™, ≥90%(SDS-PAGE)
Bioactivity	Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED50 for this effect is typically 1.15 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	72-251 aa
Sequence	LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Protein Tag	No tag
Accession #	O95150
Predicted molecular weight	20.4 kDa
SDS-PAGE	20.5 kDa, under reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human TL1A/TNFSF15 Protein (rp170417)

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - Protein Bioactivity
Measured by its ability to induce apoptosis of TF1 human erythroleukemic cells.The ED₅₀ for this effect is typically 1.15 ng/mL.

SDS-PAGE: Recombinant Human TL1A/TNFSF15 Protein (rp170417)

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - SDS-PAGE
3 μg/lane of Recombinant Human TL1A/TNFSF15 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 20.5 kDa under reducing conditions.

Protein Bioactivity: Recombinant Human TL1A/TNFSF15 Protein (rp170417)

Recombinant Human TL1A/TNFSF15 Protein (rp170417) - Protein Bioactivity
TF-1 cells were co-stimulated with 10 μg/mL CHX (C112766) and 200 ng/mL Recombinant Human TL1A/TNFSF15 Protein (rp170417) for 24 hours. Cells were then stained with Annexin V-FITC/PI Apoptosis Detection Kit (A266226) and analyzed by FACS.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration