Skip to the beginning of the images gallery

Recombinant Human TGF-beta 1 GMP Protein

Grade & Purity:

≥97%(SDS-PAGE&SEC-HPLC)

Expression System: CHO
Accession #: P01137.2
Protein Tag: No tag
Bioactivity: Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.04-0.2 ng/mL.The specific activity of recombinant human TGF-β1 GMP is >1.0 x 10^7 units/mg, which is calibrated against the human TGF‑β1 Standard (NIBSC code: 89/514).
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp168406-GMP

Grouped product items
SKU	Size	Availability	Price	Qty
rp168406-GMP-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,129.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, CHO, No tag, 279-390 aa

View related series

Click to view protein information: TGFB1

Accession#:P01137 (10) Gene ID:7040 (10) TGF beta1 (1)

Basic Description

Product Name	Recombinant Human TGF-beta 1 GMP Protein
Synonyms	CED \| LAP \| DPD1 \| latency-associated peptide \| TGF beta \| TGF beta1 \| TGFB \| TGFB1 \| TGF-beta 1 protein \| TGFbeta 1 \| TGF-beta 1 \| TGFbeta \| TGF-beta-1 \| transforming growth factor beta-1 \| transforming growth factor, beta 1 \| IBDIMDE
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity	ActiBioPure™, Bioactive, GMP, Animal Free, Carrier Free, High performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms	Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an impo
Bioactivity	Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.04-0.2 ng/mL.The specific activity of recombinant human TGF-β1 GMP is >1.0 x 10^7 units/mg, which is calibrated against the human TGF‑β1 Standard (NIBSC code: 89/514).
Endotoxin Concentration	<0.1 EU/μg
Expression System	CHO
Amino Acids	279-390 aa
Sequence	ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Protein Tag	No tag
N-terminal Sequence	Ala-Leu-Asp-Thr-Asn-Tyr-(Cys)-Phe-Ser-Ser
Accession #	P01137.2
Predicted molecular weight	12.8 kDa (monomer)
SDS-PAGE	12 kDa, under reducing conditions. 24 kDa, under non-reducing conditions.

Storage and Shipping

Reconstitution	Reconstitute at 100 μg/mL in 4 mM HCl.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -28 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration