Skip to the beginning of the images gallery

Recombinant Human Siglec-2/CD22 Protein

Grade & Purity:

≥90%(SDS-PAGE)

Expression System: HEK293
Accession #: P20273
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL. Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp169575

Grouped product items
SKU	Size	Availability	Price
rp169575-10μg	10μg	4	$139.90
rp169575-50μg	50μg	2	$299.90
rp169575-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$399.90
rp169575-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,999.90

Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-His tag, 1-687 aa

View related series

Click to view protein information: CD22

Accession#:P20273 (13) CD22 (15) Gene ID:933 (14) Siglec-2/CD22 (1)

Basic Description

Product Name	Recombinant Human Siglec-2/CD22 Protein
Synonyms	B-cell receptor CD22 \| BL-CAM \| B-lymphocyte cell adhesion molecule \| CD22 antigenMGC130020 \| CD22 molecule \| CD22 \| sialic acid binding Ig-like lectin 2 \| Sialic acid-binding Ig-like lectin 2 \| Siglec2 \| Siglec-2 \| SIGLEC2FLJ22814 \| T-cell surface antige
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free
Product Description	Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： Siglecs (sialic acid binding Ig-like lectins) are I-type (Ig-type) lectins belonging to the Ig superfamily. They are characterized by an N-terminal Ig-like V-type domain which mediates sialic acid binding, followed by varying numbers of Ig-like C2-type domains. Eleven human Siglecs have been cloned and characterized. They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and the identified Siglecs 5 to 11. To date, no Siglec has been shown to recognize any cell surface ligand other than sialic acid, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs. Human Siglec-2, also known as B-cell antigen CD22 or B-lymphocyte cell adhesion molecule (BL-CAM), is a B-cell restricted glycoprotein that is expressed in the cytoplasm of progenitor B and pre-B cells and on the surface of mature B cells. Two distinct human Siglec-2/CD22 cDNAs that arise from differential RNA processing of the same gene have been isolated. The predominant Siglec-2/CD22 beta encodes an 847 amino acid (aa) polypeptide with a hydrophobic signal peptide, an N-terminal Ig-like V-type domain, six Ig-like C2-type domains, a transmembrane region and a cytoplasmic tail with 4 immunoreceptor tyrosine-based inhibition motifs (ITIMs). The variant Siglec-2/CD22 alpha encodes a 647 aa polypeptide missing two Ig-like C2-type domains and has a truncated (23 aa) cytoplasmic tail. Siglec-2/CD22 is an adhesion molecule that preferentially binds alpha 2,6- linked sialic acid on the same (cis) or adjacent (trans) cells. Interaction of CD22 with trans ligands on opposing cells was found to be favored over the binding of ligands in cis. Besides its role as an adhesion molecule, Siglec-2/CD22 is a coreceptor that physically interacts with B-cell receptor (BCR) and is rapidly phosphorylated upon BCR ligation. It negatively regulates BCR signals by recruiting tyrosine phosphatase SHP-1 to its ITIMs. Phosphorylated Siglec-2/CD22 can also interact with other intracellular effector proteins such as Syk, PLC gamma, PI3 kinase and Grb-2, suggesting it may play a role in positive signaling.
Specifications & Purity	Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥90%(SDS-PAGE)
Bioactivity	Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL. Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-687 aa
Sequence	MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRHHHHHH
Protein Tag	C-His
Accession #	P20273
Predicted molecular weight	75.8 kDa
SDS-PAGE	115.2 kDa, under reducing conditions; 106.3 kDa, under non-reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human Siglec-2/CD22 Protein (rp169575)

Recombinant Human Siglec-2/CD22 Protein (rp169575) - ELISA
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind Inotuzumab (anti-CD22) (Ab176429) with the EC50 of 20.1 ng/mL.

ELISA: Recombinant Human Siglec-2/CD22 Protein (rp169575)

Recombinant Human Siglec-2/CD22 Protein (rp169575) - ELISA
Immobilized Recombinant Human Siglec-2/CD22 Protein (rp169575) at 1.0 μg/mL can bind bind Epratuzumab (anti-CD22) (Ab175532) with the EC50 of 207.0 ng/mL.

SDS-PAGE: Recombinant Human Siglec-2/CD22 Protein (rp169575)

Recombinant Human Siglec-2/CD22 Protein (rp169575) - SDS-PAGE
3 μg/lane of Recombinant Human Siglec-2/CD22 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 115.2 kDa under reducing conditions and 106.3 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0606791	Certificate of Analysis	Jun 14, 2024	rp169575
ZJ24F0606790	Certificate of Analysis	Jun 14, 2024	rp169575
ZJ24R0500608	Certificate of Analysis	Jun 02, 2024	rp169575

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration