Skip to the beginning of the images gallery

Recombinant Human ROR1 Protein, >95% (SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: Q01973
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human ROR1 Protein (rp176297) at 2.0 μg/mL can bind Zilovertamab (anti-ROR1) (Ab170644) , the EC50 is 16.07 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp176297

Grouped product items
SKU	Size	Availability	Price
rp176297-10μg	10μg	≥10	$89.90
rp176297-50μg	50μg	10	$299.90
rp176297-100μg	100μg	5	$459.90
rp176297-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,999.90

Animal Free, >95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-403 aa

View related series

Click to view protein information: ROR1

Accession#:Q01973 (3) Gene ID:4919 (3) ROR1 (3)

Basic Description

Product Name	Recombinant Human ROR1 Protein, >95% (SDS-PAGE), high purity
Synonyms	dJ537F10.1 \| Inactive tyrosine protein kinase transmembrane receptor ROR1 \| MGC99659 \| Neurotrophic tyrosine kinase \| Neurotrophic tyrosine kinase receptor related 1 \| Neurotrophic tyrosine kinase, receptor related 1 \| NTRKR1 \| OTTHUMP00000010573 \| OTTHUM
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining Description: ROR1 (Receptor tyrosine kinase-like orphan receptor 1), also known as neurotrophic tyrosine kinase receptor-related 1 (NTRKR1), is a member of the ROR family within the receptor tyrosine kinases (RTK) superfamily. Two ROR family members (ROR1 and ROR2) have been identified and are characterized by their intracellular tyrosine kinase domains, which are highly related to those of the Trk-family receptor tyrosine kinases, and by their extracellular Frizzled-like cysteine-rich domains and kringle domains, common to receptors of the Wnt family members. Human ROR1 is a type I transmembrane protein with 937 amino acids in length. It contains a 29 amino acid signal sequence, a 377 amino acid extracellular domain (ECD), a 21 amino acid transmembrane segment, and a 510 amino acid cytoplasmic region. Human ROR1 shares 97% and 58% amino acid sequence identity with mouse ROR1 and human ROR2, respectively. ROR1 has been shown to play crucial roles in developmental morphogenesis by acting as receptors or co-receptors to mediate Wnt5a-induced signaling. The bioactivity of ROR1 is measured by its ability to bind biotinylated recombinant mouse Wnt-5a in a functional ELISA.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Bioactivity	Immobilized Recombinant Human ROR1 Protein (rp176297) at 2.0 μg/mL can bind Zilovertamab (anti-ROR1) (Ab170644) , the EC50 is 16.07 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-403 aa
Sequence	MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEHHHHHH
Protein Tag	C-His
Accession #	Q01973
Predicted molecular weight	42.8 kDa
SDS-PAGE	56.7-66.3 kDa, under reducing conditions; 52.4-61.0 kDa, under non-reducing condition

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human ROR1 Protein (rp176297)

Recombinant Human ROR1 Protein (rp176297) - ELISA
Immobilized Recombinant Human ROR1 Protein (rp176297) at 2.0 μg/mL can bind Zilovertamab (anti-ROR1) (Ab170644), the EC₅₀ is 16.07 ng/mL.

SDS-PAGE: Recombinant Human ROR1 Protein (rp176297)

Recombinant Human ROR1 Protein (rp176297) - SDS-PAGE
3 μg/lane of Recombinant Human ROR1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 56.7-66.3 kDa under reducing conditions and 52.4-61.0 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0303306	Certificate of Analysis	Mar 22, 2024	rp176297
ZJ24F0303307	Certificate of Analysis	Mar 22, 2024	rp176297
ZJ24F0303308	Certificate of Analysis	Mar 22, 2024	rp176297
ZJ24R0300321	Certificate of Analysis	Mar 08, 2024	rp176297

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration