Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp192150-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$89.90
|
|
|
rp192150-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$269.90
|
|
|
rp192150-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$429.90
|
|
|
rp192150-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Carrier Free, ≥85% (SDS-PAGE), E. coli, N-His, 2-265 aa
| Product Name | Recombinant Human PQBP1 Protein |
|---|---|
| Synonyms | 38 kDa nuclear protein containing a WW domain, MRX55, MRXS3, MRXS8, Npw38, NPW38mental retardation, X-linked 55, nuclear protein containing WW domain 38 kD, polyglutamine binding protein 1, Polyglutamine tract-binding protein 1, polyglutamine-binding prot |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥85%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Polyglutamine binding protein 1, also known as PQBP1, is a transcription repressor that associates with polyglutamine tract-containing transcription regulators and causative genes for neurodegenerative disorders. PQBP-1 localizes to the nucleus and is pre |
| Endotoxin Concentration | <1.0 EU/μg |
| Amino Acids | 2-265 aa |
| Sequence | MHHHHHHPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
| Accession # | O60828 |
| Predicted molecular weight | 31.3 kDa |
| SDS-PAGE | 34.2 kDa, under reducing conditions; 34.2 kDa, under non-reducing conditions. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
|---|---|
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Human PQBP1 Protein (rp192150) - SDS-PAGE
3 μg/lane of Recombinant Human PQBP1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 34.2 kDa.