Skip to the beginning of the images gallery

Recombinant Human MMP-9 Protein

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: P14780
Protein Tag: C-His
Bioactivity: 1. Measured in a cell migration assay using A549 cells. 5.0 ng/mL of Recombinant Human MMP-9 can effectively induce A549 cells migration. 2. Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp181214

Grouped product items
SKU	Size	Availability	Price
rp181214-10μg	10μg	≥10	$139.90
rp181214-50μg	50μg	10	$299.90
rp181214-100μg	100μg	10	$399.90
rp181214-1mg	1mg	1	$2,999.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-707 aa

View related series

Click to view protein information: MMP9

Accession#:P14780 (4) Gene ID:4318 (4) MMP-9 (1) MMP9 (5)

Basic Description

Product Name	Recombinant Human MMP-9 Protein
Synonyms	matrix metalloproteinase-9 \| MMP9 \| MMP-9 \| type V collagenase \| 92 kDa gelatinase \| 92 kDa type IV collagenase \| CLG4B \| EC 3.4.24 \| EC 3.4.24.35 \| Gelatinase B \| GELB \| macrophage gelatinase \| MANDP2 \| matrix metallopeptidase 9 \| matrix metalloproteinas
Grade	Animal Free, Bioactive, Carrier Free, High Performance
Product Description	Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： Matrix metalloproteinases are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-9 (gelatinase B) can degrade a broad range of substrates including gelatin, collagen types IV and V, elastin and proteoglycan core protein. It is believed to act synergistically with interstitial collagenase (MMP-1) in the degradation of fibrillar collagens as it degrades their denatured gelatin forms. MMP-9 is produced by keratinocytes, monocytes, macrophages and PMN leukocytes. MMP-9 is present in most cases of inflammatory responses. Structurally, MMP-9 maybe be divided into five distinct domains: a pro-domain which is cleaved upon activation, a gelatin-binding domain consisting of three contiguous fibronectin type II units, a catalytic domain containing the zinc binding site, a proline-rich linker region, and a carboxyl terminal hemopexin-like domain.
Specifications & Purity	Animal Free, Carrier Free, Bioactive, High performance, ≥95%(SDS-PAGE)
Bioactivity	1. Measured in a cell migration assay using A549 cells. 5.0 ng/mL of Recombinant Human MMP-9 can effectively induce A549 cells migration. 2. Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-707 aa
Sequence	MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDHHHHHH
Protein Tag	C-His
Accession #	P14780
Predicted molecular weight	77.2 kDa
SDS-PAGE	81.8-106.3 kDa, under reducing condition.

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human MMP-9 Protein (rp181214)

Recombinant Human MMP-9 Protein (rp181214) - ELISA
Immobilized Recombinant Human MMP-9 Protein (rp181214) at 1.0 μg/mL can bind Andecaliximab (anti-MMP9), the EC50 for this effect is 12.14 ng/mL.

SDS-PAGE: Recombinant Human MMP-9 Protein (rp181214)

Recombinant Human MMP-9 Protein (rp181214) - SDS-PAGE
2 μg/lane of Recombinant Human MMP-9 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 81.8-106.3 kDa under reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

5 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0606592	Certificate of Analysis	Jun 07, 2024	rp181214
ZJ24F0606573	Certificate of Analysis	Jun 07, 2024	rp181214
ZJ24F0606572	Certificate of Analysis	Jun 07, 2024	rp181214
ZJ24F0606571	Certificate of Analysis	Jun 07, 2024	rp181214
ZJ24F0606570	Certificate of Analysis	Jun 07, 2024	rp181214

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration