Skip to the beginning of the images gallery

Recombinant Human Insulin Protein, CAS No.11061-68-0

Grade & Purity:

≥99%(SEC-HPLC)
≥15 U/mg

Accession #: P01308
Bioactivity: ≥15 U/mg
Endotoxin Concentration: <10 EU/mg

In stock

Item Number

rp218456

Grouped product items
SKU	Size	Availability	Price
rp218456-10mg	10mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$29.90
rp218456-50mg	50mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$109.90
rp218456-100mg	100mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$179.90
rp218456-500mg	500mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$459.90
rp218456-1g	1g	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$699.90

GMP, ≥99% (SEC-HPLC), Active, Yeast, No tag, 25-54 aa & 90-110 aa

View related series

Click to view protein information: INS

Accession#:P01308 (6) Gene ID:3630 (6) INS (6) Insulin (1) Receptor Tyrosine Kinase (1260)

Basic Description

Product Name	Recombinant Human Insulin Protein, CAS No.11061-68-0
Synonyms	ins \| INS_HUMAN \| Insulin A chain \| Insulin B chain \| Preproinsulin \| Proinsulin \| Proinsulin precursor \| IDDM \| ILPR \| IRDN \| IDDM1 \| IDDM2 \| PNDM4 \| MODY10
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity	Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High Performance, ≥99%(SEC-HPLC), ≥15 U/mg
Biochemical and Physiological Mechanisms	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Bioactivity	≥15 U/mg
Endotoxin Concentration	<10 EU/mg
Amino Acids	25-54 aa & 90-110 aa
Sequence	A Chain：GIVEQCCTSICSLYQLENYCN B Chain：FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Accession #	P01308
Predicted molecular weight	5808 Da

Taxonomic Classification

Taxonomy Tree

Kingdom Organic compounds
- Superclass Organic Polymers
  - Class Polypeptides

Kingdom	Organic compounds
Superclass	Organic Polymers
Class	Polypeptides
Subclass	Not available
Intermediate Tree Nodes	Not available
Direct Parent	Polypeptides
Alternative Parents	Cyclic peptides Hexacarboxylic acids and derivatives Tyrosine and derivatives Arginine and derivatives Phenylalanine and derivatives Histidine and derivatives Glutamic acid and derivatives Glutamine and derivatives Asparagine and derivatives Isoleucine and derivatives Leucine and derivatives Valine and derivatives Proline and derivatives N-acyl-alpha amino acids Alpha amino acid amides Amphetamines and derivatives Pyrrolidinecarboxamides N-acylpyrrolidines 1-hydroxy-2-unsubstituted benzenoids Beta hydroxy acids and derivatives Aralkylamines N-acyl amines Tertiary carboxylic acid amides Heteroaromatic compounds Imidazoles Primary carboxylic acid amides Guanidines Secondary carboxylic acid amides Organic disulfides Secondary alcohols Lactams Amino acids Azacyclic compounds Carboxylic acids Carboximidamides Carbonyl compounds Hydrocarbon derivatives Imines Monoalkylamines Organic oxides Organopnictogen compounds Primary alcohols
Molecular Framework	Aromatic heteropolycyclic compounds
Substituents	Polypeptide - Hexacarboxylic acid or derivatives - Cyclic alpha peptide - Tyrosine or derivatives - Arginine or derivatives - Phenylalanine or derivatives - Histidine or derivatives - Glutamic acid or derivatives - Glutamine or derivatives - Asparagine or derivatives - Leucine or derivatives - Isoleucine or derivatives - N-acyl-alpha amino acid or derivatives - N-acyl-alpha-amino acid - Valine or derivatives - Proline or derivatives - Alpha-amino acid amide - Alpha-amino acid or derivatives - Amphetamine or derivatives - N-substituted-alpha-amino acid - N-acylpyrrolidine - Pyrrolidine carboxylic acid or derivatives - Pyrrolidine-2-carboxamide - Phenol - 1-hydroxy-2-unsubstituted benzenoid - Aralkylamine - Beta-hydroxy acid - N-acyl-amine - Fatty amide - Fatty acyl - Monocyclic benzene moiety - Hydroxy acid - Benzenoid - Heteroaromatic compound - Pyrrolidine - Azole - Tertiary carboxylic acid amide - Imidazole - Amino acid or derivatives - Amino acid - Guanidine - Lactam - Secondary carboxylic acid amide - Organic disulfide - Carboxamide group - Primary carboxylic acid amide - Secondary alcohol - Organoheterocyclic compound - Carboximidamide - Carboxylic acid - Azacycle - Carboxylic acid derivative - Alcohol - Imine - Primary aliphatic amine - Organonitrogen compound - Carbonyl group - Organooxygen compound - Primary alcohol - Primary amine - Hydrocarbon derivative - Organic oxide - Amine - Organopnictogen compound - Organic oxygen compound - Organic nitrogen compound - Aromatic heteropolycyclic compound
Description	This compound belongs to the class of organic compounds known as polypeptides. These are peptides containing ten or more amino acid residues.
External Descriptors	Not available
1. Djoumbou Feunang Y, Eisner R, Knox C, Chepelev L, Hastings J, Owen G, Fahy E, Steinbeck C, Subramanian S, Bolton E, Greiner R, and Wishart DS. ClassyFire: Automated Chemical Classification With A Comprehensive, Computable Taxonomy. Journal of Cheminformatics, 2016, 8:61. DOI: 10.1186/s13321-016-0174-y

Storage and Shipping

Concentration	≥15 U/mg
Reconstitution	0.01mol/L HCl.
Storage Temp	Protected from light,Store at -20°C,Desiccated,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20℃ (3 years). Protect from light. Desiccated. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.
CAS	11061-68-0

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ25F0420623	Certificate of Analysis	Apr 18, 2025	rp218456
ZJ25F0420622	Certificate of Analysis	Apr 18, 2025	rp218456

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration