This is a demo store. No orders will be fulfilled.

Recombinant Human IL-15 GMP Protein

  • Expression System: E. coli
  • Accession #: P40933
  • Protein Tag: No tag
  • Bioactivity: Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.300-2.60 ng/mL. The specific activity of recombinant human IL-15 is >2.00 x 10^8 units/mg, which is calibrated against the human IL-15 reference standard (NIBSC code: 95/554).
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp166020-GMP
Grouped product items
SKU Size
Availability
Price Qty
rp166020-GMP-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$419.90
rp166020-GMP-25μg
25μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$829.90
rp166020-GMP-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$9,959.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 49-162 aa

Basic Description

Product Name Recombinant Human IL-15 GMP Protein
Synonyms Interleukin 15 | IL15 | IL-15 | MGC9721 | interleukin-15
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity Animal Free, Carrier Free, GMP, Bioactive, High performance, ActiBioPure™, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems. Stimulates the proliferation of natural kill
Bioactivity Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.300-2.60 ng/mL. The specific activity of recombinant human IL-15 is >2.00 x 10^8 units/mg, which is calibrated against the human IL-15 reference standard (NIBSC code: 95/554).
Endotoxin Concentration <0.1 EU/μg
Expression System E. coli
Amino Acids 49-162 aa
Sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Protein Tag No tag
N-terminal Sequence Asn49-Trp-Val-Asn-Val-Ile-Ser-Asp-Leu-Lys
Accession # P40933
Predicted molecular weight 13 kDa
SDS-PAGE 9 kDa under reducing conditions.

Storage and Shipping

Reconstitution Reconstitute at 100-500 μg/mL in PBS
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.