Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp166020-GMP-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$419.90
|
|
|
rp166020-GMP-25μg
|
25μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$829.90
|
|
|
rp166020-GMP-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$9,959.90
|
|
GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 49-162 aa
| Product Name | Recombinant Human IL-15 GMP Protein |
|---|---|
| Synonyms | Interleukin 15 | IL15 | IL-15 | MGC9721 | interleukin-15 |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance |
| Specifications & Purity | Animal Free, Carrier Free, GMP, Bioactive, High performance, ActiBioPure™, ≥97%(SDS-PAGE&SEC-HPLC) |
| Biochemical and Physiological Mechanisms | Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems. Stimulates the proliferation of natural kill |
| Bioactivity | Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.300-2.60 ng/mL. The specific activity of recombinant human IL-15 is >2.00 x 10^8 units/mg, which is calibrated against the human IL-15 reference standard (NIBSC code: 95/554). |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E. coli |
| Amino Acids | 49-162 aa |
| Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein Tag | No tag |
| N-terminal Sequence | Asn49-Trp-Val-Asn-Val-Ile-Ser-Asp-Leu-Lys |
| Accession # | P40933 |
| Predicted molecular weight | 13 kDa |
| SDS-PAGE | 9 kDa under reducing conditions. |
| Reconstitution | Reconstitute at 100-500 μg/mL in PBS |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl |
Starting at $599.90
Starting at $139.90