Skip to the beginning of the images gallery

Recombinant Human IL-11 Protein, ＞96% (SDS-PAGE,HPLC), high purity

Grade & Purity:

≥96%(SDS-PAGE&HPLC)

Expression System: E.coli
Accession #: P20809
Protein Tag: No tag
Bioactivity: Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <2ng/mL.
Endotoxin Concentration: <0.01 EU/μg

In stock

Item Number

rp147371

Grouped product items
SKU	Size	Availability	Price
rp147371-10μg	10μg	2	$139.90
rp147371-50μg	50μg	3	$499.90
rp147371-100μg	100μg	1	$799.90
rp147371-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,399.90

Animal Free, ≥96% (SDS-PAGE&HPLC), Active, E.coli, No tag, 22-199 aa

View related series

Click to view protein information: IL11

Accession#:P20809 (1) Gene ID:3589 (1) IL11 (1)

Basic Description

Product Name	Recombinant Human IL-11 Protein, ＞96% (SDS-PAGE,HPLC), high purity
Synonyms	Adipogenesis inhibitory factor \| AGIF \| IL-11 \| AGIF \| Adipogenesis inhibitory factor \| AGIFoprelvekin \| IL11 \| IL-11 \| IL-11Oprelvekin \| interleukin 11 \| interleukin-11 \| Oprelvekin
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Product Description	Function Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production.
Specifications & Purity	Animal Free, Carrier Free, Bioactive, ActiBioPure™, High performance, ≥96%(SDS-PAGE&HPLC)
Purity	＞96% (SDS-PAGE,HPLC)
Bioactivity	Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <2ng/mL.
Endotoxin Concentration	<0.01 EU/μg
Expression System	E.coli
Species	Human
Amino Acids	22-199 aa
Sequence	GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNL DSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTL EPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIR AAHAILGGLHLTLDWAVRGLLLLKTRL
Protein Tag	No tag
Protein Length	Full length protein
Accession #	P20809
Source	Recombinant
Predicted molecular weight	19.1 kDa

Storage and Shipping

Shape	Lyophilized
Reconstitution	This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	For long term storage, the product should be stored ≤ -20℃. 36 months, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitution. Upon receipt, it is recomm

Images

Protein Bioactivity: Recombinant Human IL-11 Protein (rp147371)

Recombinant Human IL-11 Protein (rp147371)-Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <2ng/mL.

SDS-PAGE: Recombinant Human IL-11 Protein (rp147371)

Recombinant Human IL-11 Protein (rp147371)-SDS-PAGE
3μg/lane of Recombinant Human IL-11 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 18.3 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ25F0319287	Certificate of Analysis	Mar 20, 2025	rp147371
ZJ23F0400123	Certificate of Analysis	May 04, 2023	rp147371
ZJ23F0400121	Certificate of Analysis	Apr 29, 2023	rp147371
ZJ23F0400122	Certificate of Analysis	Apr 29, 2023	rp147371

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration