This is a demo store. No orders will be fulfilled.

Recombinant Human IL-1 beta/IL-1F2 GMP Protein

  • Expression System: E. coli
  • Accession #: P01584
  • Protein Tag: No tag
  • Bioactivity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <12 pg/mL. The specific activity of recombinant human IL-1 beta is >5.0 x 10^7 IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
  • Endotoxin Concentration: <0.01 EU/μg
In stock
Item Number
rp168388-GMP
Grouped product items
SKU Size
Availability
Price Qty
rp168388-GMP-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$1,319.90
rp168388-GMP-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$6,599.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 117-269 aa

Basic Description

Product Name Recombinant Human IL-1 beta/IL-1F2 GMP Protein
Synonyms Interleukin 1 beta | catabolin | IL1 beta | IL-1 beta | IL-1 | IL1B | IL-1b | IL1-BETA | IL-1F2 | IL1F2 | interleukin 1, beta | interleukin-1 beta | preinterleukin 1 beta | pro-interleukin-1-beta | IL1beta
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity ActiBioPure™, Bioactive, GMP, Carrier Free, Animal Free, High performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast
Bioactivity Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is <12 pg/mL. The specific activity of recombinant human IL-1 beta is >5.0 x 10^7 IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
Endotoxin Concentration <0.01 EU/μg
Expression System E. coli
Amino Acids 117-269 aa
Sequence APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Protein Tag No tag
N-terminal Sequence Ala-Pro-Val-Arg-Ser-Leu-Asn-(Cys)-Thr-Leu & Pro-Val-Arg-Ser-Leu-Asn-(Cys)-Thr-Leu-Arg
Accession # P01584
Predicted molecular weight 17 kDa
SDS-PAGE 17 kDa under reducing conditions.

Storage and Shipping

Reconstitution Reconstitute at 100-200 μg/mL in PBS.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.