This is a demo store. No orders will be fulfilled.

Recombinant Human IGF-I/IGF-1 GMP Protein

  • Expression System: E. coli
  • Accession #: P05019-1
  • Protein Tag: No tag
  • Bioactivity: Measured in a serum-free cell proliferation assay using MCF7 human breast cancer cells. The ED50 for this effect is 0.3-1.5 ng/mL. The specific activity of recombinant human IGF-I/IGF-1 is >1000 IU/mg, which is calibrated against the human IGF-I/IGF-1/IGF-1 WHO International Standard (NIBSC code: 91/554).
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp168359-GMP
Grouped product items
SKU Size
Availability
Price Qty
rp168359-GMP-200μg
200μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$309.90
rp168359-GMP-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$799.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 49-118 aa

Basic Description

Product Name Recombinant Human IGF-I/IGF-1 GMP Protein
Synonyms Insulin-like Growth Factor I/Insulin-like Growth Factor 1 | IBP1 | IGF1 | IGF-1 | IGF1A | IGFI | IGF-I | IGF-IA | IGF-IB | insulin-like growth factor 1 (somatomedin C) | insulin-like growth factor 1 | insulin-like growth factor I | insulin-like growth fac
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance
Specifications & Purity Animal Free, Carrier Free, GMP, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthe
Bioactivity Measured in a serum-free cell proliferation assay using MCF7 human breast cancer cells. The ED50 for this effect is 0.3-1.5 ng/mL. The specific activity of recombinant human IGF-I/IGF-1 is >1000 IU/mg, which is calibrated against the human IGF-I/IGF-1/IGF-1 WHO International Standard (NIBSC code: 91/554).
Endotoxin Concentration <0.1 EU/μg
Expression System E. coli
Amino Acids 49-118 aa
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Protein Tag No tag
N-terminal Sequence Gly-Pro-Glu-Thr-Leu-(Cys)-Gly-Ala-Glu-Leu
Accession # P05019-1
Predicted molecular weight 7.6 kDa
SDS-PAGE 8 kDa under reducing conditions.

Storage and Shipping

Reconstitution Reconstitute at 100 μg/mL in PBS.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.