Skip to the beginning of the images gallery

Recombinant Human HVEM/TNFRSF14 Protein, >95% (SDS-PAGE&HPLC), high purity

Grade & Purity:

≥95%(SDS-PAGE&HPLC)

Expression System: Pichia pastoris
Accession #: Q92956
Protein Tag: C-Fc
Bioactivity: Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta -mediated cytotoxicity using murine L929 cells.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp152533

Grouped product items
SKU	Size	Availability	Price
rp152533-10μg	10μg	9	$49.90
rp152533-50μg	50μg	4	$129.90
rp152533-100μg	100μg	1	$199.90
rp152533-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,459.90

Animal Free, >95% (SDS-PAGE&HPLC), Active, Pichia Pastoris, C-Fc tag, 39-202 aa

View related series

Click to view protein information: TNFRSF14

Accession#:Q92956 (2) Gene ID:8764 (2) HVEM (2) TNFRSF14 (2)

Basic Description

Product Name	Recombinant Human HVEM/TNFRSF14 Protein, >95% (SDS-PAGE&HPLC), high purity
Synonyms	ATAR \| CD270 antigen \| CD270 \| CD40-like protein \| Herpes virus entry mediator A \| Herpesvirus entry mediator A \| HveA \| HVEM \| HVEMTR2HVEAATAR \| LIGHTR \| TNFRSF14 \| tumor necrosis factor receptor superfamily member 14 \| tumor necrosis factor receptor sup
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity Function >95% (SDS-PAGE&HPLC) Endotoxin level <0.1 EU/μg Function Receptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC)
Purity	>95% (SDS-PAGE&HPLC)
Bioactivity	Fully biologically active when compared to standard. The biologically active as determined by its ability to inhibit TNF-beta -mediated cytotoxicity using murine L929 cells.
Endotoxin Concentration	<0.1 EU/μg
Expression System	Pichia pastoris
Species	Human
Amino Acids	39-202 aa
Sequence	LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Protein Tag	C-Fc
Accession #	Q92956
Predicted molecular weight	58 kDa
SDS-PAGE	70 kDa, under reducing conditions

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/th

Images

SDS-PAGE: Recombinant Human HVEM/TNFRSF14 Protein (rp152533)

Recombinant Human HVEM/TNFRSF14 Protein (rp152533) - SDS-PAGE
Recombinant Human HVEM/TNFRSF14 Protein was resolved with SDS-PAGE under reducing (N) and visualized by Coomassie® Blue staining. Showing a band at 70.0 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101651	Certificate of Analysis	Nov 20, 2023	rp152533
ZJ23F1101650	Certificate of Analysis	Nov 20, 2023	rp152533
ZJ23F1101649	Certificate of Analysis	Nov 20, 2023	rp152533

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration