Skip to the beginning of the images gallery

Recombinant Human Growth Hormone R Protein, ＞95%(SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: P10912-1
Protein Tag: C-Fc & His
Bioactivity: Immobilized Human GH at 2 μg/mL (100 μL/well) can bind Human GHR with a linear range of 0.1-8.58 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp146679

Grouped product items
SKU	Size	Availability	Price
rp146679-10μg	10μg	≥10	$207.90
rp146679-50μg	50μg	8	$597.90
rp146679-100μg	100μg	3	$867.90
rp146679-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,947.90

Animal Free, >95%(SDS-PAGE), Active, 293F, Fc&His tag, 27-264 aa

View related series

Click to view protein information: GHR

Accession#:P10912 (2) Gene ID:2690 (2) GHR (2) Growth hormone R (2)

Basic Description

Product Name	Recombinant Human Growth Hormone R Protein, ＞95%(SDS-PAGE), high purity
Synonyms	GH receptor \| GH-binding protein \| GHBP \| GHBP, included \| GHR \| GHR_HUMAN \| Growth hormone binding protein \| Growth hormone receptor \| Growth hormone receptor precursor \| Growth hormone-binding protein \| Growth hormone-binding protein, included \| Increas
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity >95% SDS-PAGE. Function Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Isoform 2 up-regulates the production of GHBP and acts as a negative inhibitor of GH signaling. Post-translational The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE. Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17. On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2. On ligand binding, ubiquitinated on lysine residues in the cytoplasmic domain. This ubiquitination is not sufficient for GHR internalization.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	＞95%(SDS-PAGE)
Bioactivity	Immobilized Human GH at 2 μg/mL (100 μL/well) can bind Human GHR with a linear range of 0.1-8.58 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	27-264 aa
Sequence	AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Protein Tag	C-Fc & His
Accession #	P10912-1
Predicted molecular weight	54 kDa

Storage and Shipping

Shape	Lyophilized
Reconstitution	Reconstitute in water to a concentration of 0.1-1.0 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year.

Images

Protein Bioactivity: Recombinant Human Growth Hormone R Protein (rp146679)

Recombinant Human Growth Hormone R Protein (rp146679) - Protein Bioactivity
Immobilized Human GH at 2.0 μg/mL can bind Recombinant Human Growth Hormone R Protein (rp146679) with a linear range of 0.10 - 8.58 ng/mL. The EC₅₀ is 2.4 ng/mL.

SDS-PAGE: Recombinant Human Growth Hormone R Protein (rp146679)

Recombinant Human Growth Hormone R Protein (rp146679) - SDS-PAGE
3 μg/lane of Recombinant Human Growth Hormone R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 71.4 kDa under reducing conditions and 156.2 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0505414	Certificate of Analysis	May 15, 2024	rp146679
ZJ24F0505413	Certificate of Analysis	May 15, 2024	rp146679
ZJ24F0505412	Certificate of Analysis	May 15, 2024	rp146679

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration