Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp168357-GMP-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$549.90
|
|
|
rp168357-GMP-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$1,829.90
|
|
|
rp168357-GMP-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$14,639.90
|
|
GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, HEK293, No tag, 109-211 aa
| Product Name | Recombinant Human GDNF GMP Protein |
|---|---|
| Synonyms | Glial Cell line-derived Growth Factor | Astrocyte-derived trophic factor | ATF | ATF1 | ATF2 | GDNF | glial cell derived neurotrophic factor | glial cell line derived neurotrophic factor | glial cell line-derived neurotrophic factor | HFB1-GDNF | HGDNF | |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High Performance |
| Specifications & Purity | ActiBioPure™, Bioactive, GMP, Carrier Free, Animal Free, High performance, ≥97%(SDS-PAGE&SEC-HPLC) |
| Biochemical and Physiological Mechanisms | Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. Acts by binding to its coreceptor, GFRA1, leading to autophosphorylation and activation of the RET rece |
| Bioactivity | Measured in a cell proliferation assay using SH‑SY5Y human neuroblastoma cells. The ED50 for this effect is 2-12 ng/mL in the presence of Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera. The specific activity of recombinant human GDNF is >5.0 x 10^5 units/mg, which is calibrated against the human GDNF Reference Standard (NIBSC code: 09/266). Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human GFRα‑1/GDNF Rα‑1 Fc Chimera at 1 µg/mL can bind Recombinant Human GDNF with an apparent Kd <1 nM. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 109-211 aa |
| Sequence | RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Protein Tag | No tag |
| N-terminal Sequence | -Arg109-Gly-Gln-Arg-Gly-Lys-Asn-Arg-Gly-(Cys) |
| Accession # | P39905-1 |
| Predicted molecular weight | 11.6 kDa (monomer) |
| SDS-PAGE | 17 kDa, reducing conditions. 33 kDa, non-reducing conditions. |
| Reconstitution | Reconstitute at 100 μg/mL in PBS. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl |