Skip to the beginning of the images gallery

Recombinant Human Estrogen Receptor alpha Protein

COA

Grade & Purity:

Carrier Free

Azide Free

≥90%(SDS-PAGE)

Expression System: E. coli
Accession #: P03372
Protein Tag: N-His
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp175926

Grouped product items
SKU	Size	Availability	Price
rp175926-10μg	10μg	≥10	$139.90
rp175926-100μg	100μg	2	$499.90
rp175926-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,999.90

Carrier Free, >90% (SDS-PAGE), E.coli, His tag, 1-185 aa

View related series

Click to view protein information: ESR1

Accession#:P03372 (2) ESR1 (2) Estrogen Receptor alpha (2) Gene ID:2099 (2)

Basic Description

Product Name	Recombinant Human Estrogen Receptor alpha Protein
Synonyms	Estrogen Receptor alpha \| ER-alpha \| Estradiol receptor \| Nuclear receptor subfamily 3 group A member 1 \| ER \| Era \| ESR \| ESRA \| ESTRR \| NR3A \| 17/654 isoform \| 7/819 2 isoform \| 7/822 isoform \| 8/901 isoform \| 8*/941 isoform \| DKFZp686N23123 \| ER al
Grade	Azide Free, Carrier Free
Product Description	Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： ER alpha (Estrogen receptor alpha; also Estradiol receptor and NR3A1) is a 65-70 kDa member of the NR3 subfamily, nuclear hormone receptor family of proteins. It is widely expressed, and serves as a strong activator of estrogen-responsive genes. ER alpha is normally quiescent and bound to heat-shock proteins and immunophilins. Following beta -estradiol binding, it becomes activated, either homodimerizes or heterodimerizes with ER beta, and binds to DNA with multiple coactivators. Human ER alpha is 595 amino acids (aa) in length. It contains a DNA binding region (aa 185-250), three NLSs (aa 256-260; 266-271; 299-303), a steroid-binding site (aa 351-543), a dimerization motif (aa 497-518), and an O-GlcNAc attachment around Thr575. Major phosphorylation sites exist at Tyr537, Ser167 and Ser118. Multiple splice forms exist. There is an 80 kDa isoform that shows a substitution (duplication) of aa 412-517 for Asp411, a second isoform with a deletion of aa 255-366, a third isoform with a deletion of aa 152-412, and a fourth isoform that shows a Thr substitution for aa 152-595. Human ER alpha is only 46% aa identical to human ER beta. Over aa 1-116, human ER alpha shares 85% aa identity with mouse ER alpha.
Specifications & Purity	Carrier Free, Azide Free, ≥90%(SDS-PAGE)
Endotoxin Concentration	<1.0 EU/μg
Expression System	E. coli
Amino Acids	1-185 aa
Sequence	MHHHHHHMTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYC
Protein Tag	N-His
Accession #	P03372
Predicted molecular weight	21.0 kDa
SDS-PAGE	24.8kDa and 47.1 kDa, reducing conditions; 24.8kDa and 47.1 kDa, non-reducing conditions

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human Estrogen Receptor alpha protein (rp175926)

Recombinant Human Estrogen Receptor alpha protein (rp175926) - SDS-PAGE
Recombinant Human Estrogen Receptor alpha protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing two bands at 24.8 and 47.1 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101874	Certificate of Analysis	Dec 13, 2023	rp175926
ZJ23F1101873	Certificate of Analysis	Dec 13, 2023	rp175926
ZJ23R1100166	Certificate of Analysis	Nov 24, 2023	rp175926

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration