Skip to the beginning of the images gallery

Recombinant Human ERGIC3 Protein

COA

Grade & Purity:

Carrier Free

≥85%(SDS-PAGE)
See COA

Accession #: Q9Y282
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp192084

Grouped product items
SKU	Size	Availability	Price
rp192084-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$89.90
rp192084-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$269.90
rp192084-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$429.90
rp192084-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Carrier Free, ≥85% (SDS-PAGE), E. coli, N-His, 47-341 aa

View related series

Click to view protein information: ERGIC3

Accession#: Q9Y282 (1) ERGIC3 (1) Gene ID: 51614 (1)

Basic Description

Product Name	Recombinant Human ERGIC3 Protein
Synonyms	2310015B14Rik \| AV318804 \| C20orf47 \| CGI 54 \| D2Ucla1 \| dJ477O4.2 \| DKFZp547A2190 \| Endoplasmic reticulum Golgi intermediate compartment protein 3 \| endoplasmic reticulum localized protein ERp43 \| Endoplasmic reticulum-Golgi intermediate compartment prot
Grade	Carrier Free
Specifications & Purity	Carrier Free, ≥85%(SDS-PAGE), See COA
Biochemical and Physiological Mechanisms	ERGIC And Golgi 3, also known as ERGIC3 is a member of the ERGIC family and interacts with ERGIC1/ERGIC32. ERGIC3 takes part in the transport between endoplasmic reticulum and Golgi. One of the diseases which is associated with ERGIC3 is Breast Cancer.
Endotoxin Concentration	<1.0 EU/μg
Amino Acids	47-341 aa
Sequence	MHHHHHHYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFT
Accession #	Q9Y282
Predicted molecular weight	34.6 kDa
SDS-PAGE	36.5 kDa, under reducing conditions; 36.1-37.5 kDa, under non-reducing conditions.

Storage and Shipping

Concentration	See COA
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze/thaw cycle.

Images

SDS-PAGE: Recombinant Human ERGIC3 Protein (rp192084)

Recombinant Human ERGIC3 Protein (rp192084) - SDS-PAGE
3 μg/lane of Recombinant Human ERGIC3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.5 kDa under reducing conditions and 36.1-37.5 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration